# PaCkAgE DaTaStReAm CSWpkgutil 1 1196 # end of header 0707010020a34a000081a4000027130000271000000001502b7c650000022c000000c300000fc500000000000000000000001300000000CSWpkgutil/pkginfoPKG=CSWpkgutil NAME=pkgutil - Installs Solaris packages easily ARCH=all VERSION=2.6.5,REV=2012.08.15 CATEGORY=application VENDOR=http://pkgutil.net/ packaged for CSW by Peter Bonivart EMAIL=bonivart@opencsw.org PSTAMP=bonivart@unstable9x-20120815123929 CLASSES=none HOTLINE=http://www.opencsw.org/bugtrack/ OPENCSW_CATALOGNAME=pkgutil OPENCSW_MODE64=32 OPENCSW_REPOSITORY=https://gar.svn.sourceforge.net/svnroot/gar/csw/mgar/pkg/pkgutil/trunk@18948 OPENCSW_BUNDLE=pkgutil OPENCSW_OS_RELEASE=SunOS5.9 OPENCSW_OS_ARCH=i386 WORKDIR_FIRSTMOD=../build-isa-i386 0707010020a349000081a4000027130000271000000001502b7c6500000509000000c300000fc500000000000000000000001200000000CSWpkgutil/pkgmap: 1 1196 1 f none /etc/opt/csw/pkgutil.conf.CSW 0644 root bin 4529 3893 1345027166 1 f none /opt/csw/bin/pkgutil 0755 root bin 106494 12962 1345027167 1 f none /opt/csw/etc/pkgutil.conf.CSW 0644 root bin 4529 3893 1345027166 1 d none /opt/csw/libexec 0755 root bin 1 d none /opt/csw/libexec/pkgutil 0755 root bin 1 f none /opt/csw/libexec/pkgutil/wget-i386 0755 root bin 164576 20108 1345027166 1 f none /opt/csw/libexec/pkgutil/wget-sparc 0755 root bin 224672 8936 1345027166 1 d none /opt/csw/share/doc/pkgutil 0755 root bin 1 f none /opt/csw/share/doc/pkgutil/license 0644 root bin 18007 29780 1345027167 1 f none /opt/csw/share/doc/pkgutil/readme 0444 root bin 19728 39658 1345027166 1 d none /opt/csw/share/man/man1 0755 root bin 1 f none /opt/csw/share/man/man1/pkgutil.1 0444 root bin 19228 33163 1345027166 1 d none /opt/csw/var/pkgutil 0755 root bin 1 f none /opt/csw/var/pkgutil/admin.CSW 0644 root bin 167 16130 1345027167 1 d none /var/opt/csw/pkgutil 0755 root bin 1 d none /var/opt/csw/pkgutil/packages 0755 root bin 1 d none /var/opt/csw/pkgutil/pkgask 0755 root bin 1 i checkpkg_override 636 60118 1345027167 1 i copyright 71 6693 1345027167 1 i depend 0 0 1345027169 1 i pkginfo 556 46284 1345027173 1 i postinstall 1024 19207 1299706535 1 i preremove 826 2408 1298308976 07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!0707010020a34a000081a4000027130000271000000001502b7c650000022c000000c300000fc500000000000000000000000800000000pkginfoPKG=CSWpkgutil NAME=pkgutil - Installs Solaris packages easily ARCH=all VERSION=2.6.5,REV=2012.08.15 CATEGORY=application VENDOR=http://pkgutil.net/ packaged for CSW by Peter Bonivart EMAIL=bonivart@opencsw.org PSTAMP=bonivart@unstable9x-20120815123929 CLASSES=none HOTLINE=http://www.opencsw.org/bugtrack/ OPENCSW_CATALOGNAME=pkgutil OPENCSW_MODE64=32 OPENCSW_REPOSITORY=https://gar.svn.sourceforge.net/svnroot/gar/csw/mgar/pkg/pkgutil/trunk@18948 OPENCSW_BUNDLE=pkgutil OPENCSW_OS_RELEASE=SunOS5.9 OPENCSW_OS_ARCH=i386 WORKDIR_FIRSTMOD=../build-isa-i386 0707010020a349000081a4000027130000271000000001502b7c6500000509000000c300000fc500000000000000000000000700000000pkgmap: 1 1196 1 f none /etc/opt/csw/pkgutil.conf.CSW 0644 root bin 4529 3893 1345027166 1 f none /opt/csw/bin/pkgutil 0755 root bin 106494 12962 1345027167 1 f none /opt/csw/etc/pkgutil.conf.CSW 0644 root bin 4529 3893 1345027166 1 d none /opt/csw/libexec 0755 root bin 1 d none /opt/csw/libexec/pkgutil 0755 root bin 1 f none /opt/csw/libexec/pkgutil/wget-i386 0755 root bin 164576 20108 1345027166 1 f none /opt/csw/libexec/pkgutil/wget-sparc 0755 root bin 224672 8936 1345027166 1 d none /opt/csw/share/doc/pkgutil 0755 root bin 1 f none /opt/csw/share/doc/pkgutil/license 0644 root bin 18007 29780 1345027167 1 f none /opt/csw/share/doc/pkgutil/readme 0444 root bin 19728 39658 1345027166 1 d none /opt/csw/share/man/man1 0755 root bin 1 f none /opt/csw/share/man/man1/pkgutil.1 0444 root bin 19228 33163 1345027166 1 d none /opt/csw/var/pkgutil 0755 root bin 1 f none /opt/csw/var/pkgutil/admin.CSW 0644 root bin 167 16130 1345027167 1 d none /var/opt/csw/pkgutil 0755 root bin 1 d none /var/opt/csw/pkgutil/packages 0755 root bin 1 d none /var/opt/csw/pkgutil/pkgask 0755 root bin 1 i checkpkg_override 636 60118 1345027167 1 i copyright 71 6693 1345027167 1 i depend 0 0 1345027169 1 i pkginfo 556 46284 1345027173 1 i postinstall 1024 19207 1299706535 1 i preremove 826 2408 1298308976 0707010020a365000041ed000027130000271000000002502b7c6500000000000000c300000fc500000000000000000000000800000000install0707010020a367000081a4000027130000271000000001502b7c5f00000047000000c300000fc500000000000000000000001200000000install/copyrightPlease see /opt/csw/share/doc/pkgutil/license for license information. 0707010020a369000081a40000271300002710000000014d77f2a700000400000000c300000fc500000000000000000000001400000000install/postinstall#!/bin/sh ETC1=$PKG_INSTALL_ROOT/opt/csw/etc ETC2=$PKG_INSTALL_ROOT/etc/opt/csw VAR1=$PKG_INSTALL_ROOT/opt/csw/var/pkgutil VAR2=$PKG_INSTALL_ROOT/var/opt/csw/pkgutil echo if [ ! -f "$ETC1/pkgutil.conf" ]; then echo "Copying sample pkgutil.conf to /opt/csw/etc." cp -p $ETC1/pkgutil.conf.CSW $ETC1/pkgutil.conf else echo "/opt/csw/etc/pkgutil.conf already exists, will not copy pkgutil.conf.CSW to it." fi if [ ! -f "$ETC2/pkgutil.conf" ]; then echo "Copying sample pkgutil.conf to /etc/opt/csw." cp -p $ETC2/pkgutil.conf.CSW $ETC2/pkgutil.conf else echo "/etc/opt/csw/pkgutil.conf already exists, will not copy pkgutil.conf.CSW to it." fi if [ ! -f "$VAR2/admin" ]; then echo "Copying sample admin from /opt/csw/var/pkgutil to /var/opt/csw/pkgutil." cp -p $VAR1/admin.CSW $VAR2/admin else echo "/var/opt/csw/pkutil/admin already exists, will not copy admin.CSW to it." fi echo echo "NOTE!" echo "NOTE! Make sure to check out any changes in /etc/opt/csw/pkgutil.conf.CSW." echo "NOTE!" echo exit 0 0707010020a368000081a4000027130000271000000001502b7c6100000000000000c300000fc500000000000000000000000f00000000install/depend0707010020a366000081a4000027130000271000000001502b7c5f0000027c000000c300000fc500000000000000000000001a00000000install/checkpkg_overrideCSWpkgutil: file-with-bad-content /usr/local root/opt/csw/bin/pkgutil CSWpkgutil: discouraged-path-in-pkgmap /opt/csw/var/pkgutil CSWpkgutil: discouraged-path-in-pkgmap /opt/csw/var/pkgutil/admin.CSW CSWpkgutil: archall-with-arch-paths /opt/csw/libexec/pkgutil/wget-i386 CSWpkgutil: archall-with-binaries opt/csw/libexec/pkgutil/wget-i386 CSWpkgutil: archall-with-binaries opt/csw/libexec/pkgutil/wget-sparc CSWpkgutil: binary-wrong-architecture file=opt/csw/libexec/pkgutil/wget-i386 pkginfo-says=all actual-binary=i386 CSWpkgutil: binary-wrong-architecture file=opt/csw/libexec/pkgutil/wget-sparc pkginfo-says=all actual-binary=sparc 0707010020a36a000081a40000271300002710000000014d629f700000033a000000c300000fc500000000000000000000001200000000install/preremove#!/bin/sh ETC1=$PKG_INSTALL_ROOT/opt/csw/etc ETC2=$PKG_INSTALL_ROOT/etc/opt/csw VAR1=$PKG_INSTALL_ROOT/opt/csw/var/pkgutil VAR2=$PKG_INSTALL_ROOT/var/opt/csw/pkgutil echo if [ "`cmp "$ETC1/pkgutil.conf" "$ETC1/pkgutil.conf.CSW"`" ]; then echo "/opt/csw/etc/pkgutil.conf modified, will not remove it." else echo "Removing unmodified $ETC1/pkgutil.conf." /bin/rm $ETC1/pkgutil.conf fi if [ "`cmp "$ETC2/pkgutil.conf" "$ETC2/pkgutil.conf.CSW"`" ]; then echo "/etc/opt/csw/pkgutil.conf modified, will not remove it." else echo "Removing unmodified $ETC2/pkgutil.conf." /bin/rm $ETC2/pkgutil.conf fi if [ "`cmp "$VAR2/admin" "$VAR1/admin.CSW"`" ]; then echo "/var/opt/csw/pkgutil/admin modified, will not remove it." else echo "Removing unmodified /var/opt/csw/pkgutil/admin." /bin/rm $VAR2/admin fi exit 0 0707010020a34b000041ed000027130000271000000004502b7c6500000000000000c300000fc500000000000000000000000500000000root0707010020a350000041ed000027130000271000000003502b7c6500000000000000c300000fc500000000000000000000000900000000root/opt0707010020a351000041ed000027130000271000000007502b7c6500000000000000c300000fc500000000000000000000000d00000000root/opt/csw0707010020a354000041ed000027130000271000000002502b7c6500000000000000c300000fc500000000000000000000001100000000root/opt/csw/etc0707010020a355000081a4000027130000271000000001502b7c5e000011b1000000c300000fc500000000000000000000002200000000root/opt/csw/etc/pkgutil.conf.CSW# Configuration file for pkgutil # $Id: pkgutil.conf 448 2012-02-04 14:22:21Z bonivart $ # Master configuration file is placed in /opt/csw/etc. Place a pkgutil.conf # file in /etc/opt/csw if you want a local override setting-by-setting. # Nothing below is mandatory to change, pkgutil will use the default values # noted below for each option unless something is uncommented. # Catalog not cached # Tells your proxy server to disable caching during fetching # of the catalog and descriptions. # Default: true #catalog_not_cached=true # Catalog update interval # Number of days between automatic catalog updates. Special cases are -1 # if you want to disable automatic updates and 0 if you always want to # update the catalog. # Default: 14 #catalog_update=14 # Filter out CSWcommon from --deptree output # Set this to true if you don't want to see lots of lines with CSWcommon. # Default: false #deptree_filter_common=true # Exclude pattern # Space separated list of simple patterns that will exclude matching packages # when updating or installing. # Default: blank #exclude_pattern= # gpg homedir # The path to the gpg directory (instead of ~/.gnupg) when verifying the # catalogs integrity. # NOTE: we recommend you install the CSWcswpki package for # easiest handling of the keys # Default: blank #gpg_homedir= # Max package list length # During dependency calculation the recursive algorithm needs to be protected # against cyclic dependencies in the catalog (packages that list each other # as dependencies) or pkgutil will not stop until memory is exhausted. # Default: 100000 #maxpkglist=100000 # Mirror to use for downloads # See http://www.opencsw.org/mirrors for alternative mirrors. # NOTE: remember to include distribution (e.g. testing) at the end of the url. # NOTE: you can have multiple mirrors by defining multiple mirror lines. # Default: http://mirror.opencsw.org/opencsw/testing #mirror=http://mirror.opencsw.org/opencsw/testing # Support non-CSW packages # If you have your own packages that have a different prefix that you want # to use with pkgutil you must enable this otherwise pkgutil will skip every # package not prefixed by CSW. # NOTE: this also affects options like -c/C, however it's easy to filter the # output if wanted, e.g. "pkgutil -C CSW". # Default: false #noncsw=true # Options to use for pkgadd # You can set it to -S to skip displaying the license during install. # Solaris 10: If you wish to limit pkgutil to installing packages # only to the global zone, set it to -G. Note that pkgrm # does not have the same option. # WARNING: do not modify this unless you know what you're doing. # Default: blank #pkgaddopts=-G -S # Style of package list when installing/upgrading packages # 0 is the one used since the first version of pkgutil, it's space efficient # but less readable. 1 is the one introduced in v1.7, it's one package per # line which is easier to read. 2 is the same as 1 but also displays which # distribution a package comes from, e.g. unstable or stable. # Default: 2 #pkgliststyle=2 # Options to use for pkgrm # Solaris 10: If you wish to limit pkgutil to removing packages # only in the global zone, set it to -O nozones. # WARNING: do not modify this unless you know what you're doing. # Default: blank #pkgrmopts=-O nozones # Root path to use # WARNING: do not modify this unless you know what you're doing. # Default: / #root_path=/a # Show the current list of packages or not # You can choose to not show the list of current packages to get less output # when doing operations. # Default: true #show_current=true # How to handle soft errors from hooks that are called # A hook that exits with code 1 will cause pkgutil to stop. If this value is # true, exit code 2 will also cause pkgutil to stop. Exit code 2 is a non-fatal # error condition from a hook and it is a site dependent choice whether or # not to honour this condition. Set to true to enable. # Default: false #stop_on_hook_soft_error=false # Use of gpg, md5 # To enable use of gpg or md5, uncomment these # NOTE: it doesn't make sense to use md5 but not gpg so your options should be: # 1. both disabled, 2. gpg enabled, 3. both enabled. # Default: false, false #use_gpg=true #use_md5=true # Options to use for wget # You can also use any option from wgetrc with --execute, e.g. # "--execute http_proxy=http://proxy.foo.bar". # WARNING: do not modify this unless you know what you're doing. # Default: blank #wgetopts=-U pkgutil 0707010020a352000041ed000027130000271000000002502b7c6500000000000000c300000fc500000000000000000000001100000000root/opt/csw/bin0707010020a353000081a4000027130000271000000001502b7c5f00019ffe000000c300000fc500000000000000000000001900000000root/opt/csw/bin/pkgutil#!/bin/sh #! -*- perl -*- eval 'PATH=/opt/csw/bin:$PATH:/usr/perl5/bin exec perl -x -w $0 ${1+"$@"}' if 0; # pkgutil - manages packages on Sun/Oracle Solaris systems # Copyright (C) 2008-2012 Peter Bonivart # $Id: pkgutil 457 2012-08-15 10:33:22Z bonivart $ # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2 of the License, or # (at your option) any later version. # # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA. # # The author, Peter Bonivart, can be contacted by email at bonivart@opencsw.org use strict; use Cwd; use Getopt::Long; Getopt::Long::Configure qw( no_ignore_case bundling ); use Symbol qw( gensym ); # Unbuffered output $| = 1; # Signal handlers $SIG{HUP} = 'IGNORE'; $SIG{TERM} = $SIG{INT} = $SIG{QUIT} = \&signal_handler; # Untainting delete @ENV{qw(LD_LIBRARY_PATH IFS CDPATH ENV BASH_ENV)}; # Make %ENV safer $ENV{'PATH'} = '/bin:/usr/bin'; $ENV{'LANG'} = 'C'; # Ensure we always work from a directory that won't # be yanked out from under pkgadd/pkgrm. chdir('/'); my $debug = 0; my $pkgutilver = "2.6.5"; my $use_md5 = 0; my $use_gpg = 0; my $noncsw = 0; my $pkgliststyle = 2; my $maxpkglist = 100000; my @mirror; my $defaultmirror = ("http://mirror.opencsw.org/opencsw/testing"); my $workdir = "/var/opt/csw/pkgutil"; my $pkgdir; my $admin; my $logfile; my ( $line, $tmp, $wget, $yes, $force, $nomod, $gzip, $name, $ver, $pkgname, $filename ); my ( $size, $deps, $cat, $tmppkg, $tmppkg2, $trace, $hash ); my ( @exclude, %config, %pkg, %commonpkg, %pkgmirror, %catinfo, %state ); # Show available packages in catalog (-a/A) # mode - 0 = display available packages (-a) # 1 = compare available packages to those installed (-A) # parse - 0 = normal output, 1 = machine parsable output sub available { my ( $mode, $parse ) = @_; my $tmp; my $local_ver; unless ($parse) { # No header when --parse is being used if ( $mode == 0 ) { print "common package catalog size\n"; } else { print "package\t\t\t catalog\t\t installed\n"; } } my $hit = 0; foreach my $common ( sort keys %commonpkg ) { my $pkgname = $commonpkg{$common}; foreach my $remote_ver ( sort keys %{ $pkg{$pkgname} } ) { my ($size) = ( split /\s+/, $pkg{$pkgname}{$remote_ver} )[5]; if ( $mode == 0 ) { if ($parse) { $tmp = "$common\t$pkgname\t$remote_ver\t$size\n"; } else { $tmp = sprintf( "%-20s %-20s %-25s %9s\n", $common, $pkgname, $remote_ver, format_byte($size) ); } } else { $local_ver = check_pkg( $pkgname, 0 ); $local_ver = "SAME" if ( $local_ver eq $remote_ver ); $local_ver = "not installed" if ( $local_ver eq "notinst" ); if ($parse) { $tmp = "$pkgname\t$remote_ver\t$local_ver\n"; } else { $tmp = sprintf( "%-25s %-25s %-25s\n", $pkgname, $remote_ver, $local_ver ); } } if ( scalar(@ARGV) > 0 ) { foreach (@ARGV) { if ( "$pkgname-$remote_ver" =~ /$_/ || "$common-$remote_ver" =~ /$_/ ) { print $tmp; $hit = 1; } } } else { print $tmp; $hit = 1; } } } # Do fuzzy matching if nothing found unless ( $hit || $parse || $mode ) { print "\nNo exact matches found, doing fuzzy matching for first argument ($ARGV[0]) ...\n"; eval { require String::Approx; }; # Check for String::Approx if ($@) { myexit( "String::Approx required for fuzzy matching not found, install with pkgutil -i CSWpmstringapprox to enable.", "", 0 ); } else { my @match = String::Approx::amatch( $ARGV[0], %commonpkg ); if ( scalar(@match) ) { print "Suggestions: "; foreach (@match) { print "$_ "; } print "\n"; } } } myexit( "", "", 0 ); } # display catalog info sub catalog_info { foreach ( sort keys %catinfo ) { print "\n"; print "URL\t\t" . $catinfo{$_}{url} . "\n"; print "Release\t\t" . $catinfo{$_}{RELEASE} . "\n"; print "Creation time\t" . $catinfo{$_}{CREATIONDATE} . "\n"; print "Number of pkgs\t" . $catinfo{$_}{num_of_pkgs} . "\n"; print "File\t\t" . $catinfo{$_}{filename} . "\n"; print "GPG\t\t" . $catinfo{$_}{gpg} . "\n" if $use_gpg; } myexit( "", "", 0 ); } # check binary to avoid trying to use broken wget for example # bin - binary to check sub check_binary { my ($bin) = @_; print STDERR "DEBUG:Checking binary: $bin ... " if $debug; my $status = system("/bin/sh -c '$bin --version' >/dev/null 2>/dev/null"); print "" . ( ($status) ? "fail" : "OK" ) . "\n" if $debug; return 1 if $status; } # Check catalog # always - always update catalog # parse - pass through to silence gpg checks sub check_catalog { my ( $always, $parse ) = @_; foreach my $url (@mirror) { my $filename = mangle_url($url); my $age = 0; $age = -M $filename if ( -r $filename ); print STDERR "DEBUG:Catalog $url age in days: $age\n" if $debug; fetch_catalog( $url, $filename ) if ( ( $age > $config{catalog_update} && $config{catalog_update} != -1 ) || !-e $filename || $always ); gpg( $filename, $parse ) if $use_gpg; my $entries = read_catalog( $url, $filename ); # Once per file print "==> $entries package" . ( $entries > 1 ? "s" : "" ) . " loaded from $filename\n" if ( ( $age > $config{catalog_update} && $config{catalog_update} != -1 ) || !-e $filename || $always || $debug ); } } # Check if package is already installed and if so, which version # pkg - package to check for # mode - 0 = return full string, 1 = return only rev part sub check_pkg { my ( $pkg, $mode ) = @_; my ( $tmp, $exit_code, $retvalue ); my $root_path = $config{root_path} ? "-R $config{root_path}" : ""; my $test_path = $config{root_path} ? $config{root_path} : ""; if ( !-d "$test_path/var/sadm/pkg/$pkg" ) { $retvalue = "notinst"; print STDERR "DEBUG:$pkg not installed\n" if $debug; } else { $tmp = `/bin/pkgparam $root_path $pkg VERSION 2> /dev/null`; chomp $tmp; if ( $mode == 0 ) { $retvalue = $tmp; } else { ($retvalue) = ( $tmp =~ /REV=(.+)$/ ); } print STDERR "DEBUG:$pkg installed, version $retvalue\n" if $debug; } return $retvalue; } # Clean up obsolete packages (--cleanup) sub cleanup { my @legacy = list_obsolete(); print STDERR "DEBUG:" . scalar(@legacy) . " legacy: " . join( " ", @legacy ) . "\n" if $debug; my @deps = list_deps(); print STDERR "DEBUG:" . scalar(@deps) . " deps: " . join( " ", @deps ) . "\n" if $debug; my @obsolete; foreach my $pkg (@legacy) { push( @obsolete, $pkg ) unless ( grep { /^\Q$pkg\E$/ } @deps ); } my $pkgsep = ( $pkgliststyle ? "\n\t" : " " ); print scalar(@obsolete) . " OBSOLETE package" . ( scalar(@obsolete) > 1 ? "s" : "" ); if ( scalar(@obsolete) ) { print ":$pkgsep" . join( "$pkgsep", @obsolete ) . "\n"; rem_pkgs(@obsolete); } else { print "s.\n\n"; } myexit( "", "", 0 ); } # Compare current to available packages (-c/C) # mode - 0 = print full list, 1 = return list of old packages # 2 = return full list of old packages, 3 = same as 0 but only diffs # 4 = compare a single package (much faster, used with Puppet) # parse - 0 = normal output, 1 = machine parsable output sub compare { my ( $mode, $parse ) = @_; my ( @cswpkgs, @retlist ); my ( $local_ver, $remote_ver, $tmp ); my $root_path = $config{root_path} ? "-R $config{root_path}" : ""; unless ($parse) { # No header when --parse is being used print "package\t\t\t installed\t\t catalog\n" if ( $mode == 0 || $mode == 3 ); } if ( $mode == 4 ) { $cswpkgs[0] = "a " . parse_catalog( $ARGV[0], 2 ) . " a"; myexit( "Not in catalog", "", 0 ) if ( $cswpkgs[0] eq "a not in catalog a" ); } else { if ($noncsw) { @cswpkgs = `/bin/pkginfo $root_path`; } else { @cswpkgs = `/bin/pkginfo $root_path | grep CSW`; } } foreach my $pkg (@cswpkgs) { ($pkg) = ( $pkg =~ /\s+?(\S+?)\s/ ); $local_ver = check_pkg( $pkg, 0 ); $remote_ver = parse_catalog( $pkg, 1 ); $remote_ver = "SAME" if ( $local_ver eq $remote_ver ); if ( $mode == 1 ) { push( @retlist, $pkg ) if ( $remote_ver ne "SAME" && $remote_ver ne "not in catalog" ); } else { if ($parse) { $tmp = "$pkg\t$local_ver\t$remote_ver\n"; } else { $tmp = sprintf( "%-25s %-25s %-25s\n", $pkg, $local_ver, $remote_ver ); } if ( $mode == 2 ) { push( @retlist, $tmp ) if ( $remote_ver ne "SAME" && $remote_ver ne "not in catalog" ); } else { if ( scalar(@ARGV) > 0 && $mode != 4 ) { foreach (@ARGV) { if ( $pkg =~ /$_/ ) { print $tmp unless ( $mode == 3 && $remote_ver eq "SAME" ); } } } else { print $tmp unless ( $mode == 3 && $remote_ver eq "SAME" ); } } } } if ( $mode == 1 || $mode == 2 ) { return @retlist; } else { myexit( "", "", 0 ); } } # Deduplicate a list # list - list to deduplicate sub dedup { my @list = @_; my %deduped; my @tmplist; for my $pkg (@list) { unless ( exists $deduped{$pkg} ) { push( @tmplist, $pkg ); $deduped{$pkg} = 1; } } return @tmplist; } # Display package dependencies as a tree (--deptree) # depth - number of levels to show sub deptree { my ($depth) = @_; my ( @pkgarray, @rest, @j ); my $level = 0; my $true; foreach (@ARGV) { undef @pkgarray; $pkgarray[0] = $_; foreach (@pkgarray) { my $pkg = parse_catalog( $_, 2 ); # Get package name my $deps = parse_catalog( $_, 6 ); # Get dependencies unless ( $pkg eq "CSWcommon" && $config{deptree_filter_common} eq "true" || $level > $depth ) { for ( my $i = 0 ; $i < $level ; $i++ ) { print "- "; } print "$pkg\n"; } if ( $deps ne "none" ) { my @tmplist = split( /\|/, $deps ); unshift( @rest, @tmplist ); # Add deps to rest list $level++; # Increment level $j[$level] = scalar(@tmplist); # Nr of deps on this level } push( @pkgarray, shift(@rest) ) if ( scalar(@rest) > 0 ); $true = 1; while ( $true && $level > 0 ) { # How many levels do we need to back up? if ( $deps eq "none" && $j[$level] == 0 ) { $level--; } else { $true = 0; } } $j[$level]--; # Lower nr of remaining deps on this level } } myexit( "", "", 0 ); } # Describe available packages (--describe) # parse - 0 = normal output, 1 = machine parsable output sub describe { my ($parse) = @_; my $desc_file = mangle_url( $mirror[0] ); $desc_file =~ s|/catalog\.|/descriptions\.|; myexit( "No descriptions file available. Try pkgutil -U.", "", 1 ) unless ( -r $desc_file && -s _ ); my $DESC = gensym(); open( $DESC, "<$desc_file" ); while ( my $line = <$DESC> ) { chomp $line; $line =~ s/ - /\t/ if $parse; if ( scalar(@ARGV) > 0 ) { foreach (@ARGV) { print "$line\n" if ( $line =~ /$_/ ); } } else { print "$line\n"; } } close $DESC; myexit( "", "", 0 ); } # Email notifications when updates are available (-e) # email - address to send notications to sub email { my ($email) = @_; my $file; my $TMP = gensym(); eval { require File::Temp; }; # Check for File::Temp $file = "/tmp/pkgutil.$$.$^T" if ($@); # Use less safe method if File::Temp not available myexit( "Mailx not found on system!", "", 1 ) unless ( -x "/bin/mailx" ); my @update_list = compare(2); if ( scalar(@update_list) > 0 ) { if ( defined $file ) { open( $TMP, ">$file" ) or myexit( "Can't open $file", "$!", 1 ); } else { ( $TMP, $file ) = File::Temp::tempfile( DIR => "/tmp" ); } foreach (@update_list) { print $TMP $_; } chomp( my $host = `uname -n` ); my $subject = "$host: CSW updates available"; my @args = ("/bin/mailx -s \"$subject\" $email < $file"); system(@args); unlink $file; close $TMP; } myexit( "", "", 0 ); } # Extract downloaded packages (--extract) # pkglist - list of packages to extract (from install sub) sub extract_pkg { my (@pkglist) = @_; foreach (@pkglist) { # pkgtrans them one by one my $file = parse_catalog( $_, 3 ); print "Extracting $_ to $pkgdir/" . parse_catalog( $_, 2 ) . " ...\n"; my $status = system( "$gzip -c -f -d $pkgdir/$file | /bin/pkgtrans /dev/fd/0 $pkgdir all 2> /dev/null" ); myexit( "Could not extract $file (directory may already exist)", "", 1 ) if $status; } } # Fetch catalog # url - url to download from # filename - filename to use for local catalog sub fetch_catalog { my ( $url, $filename ) = @_; my $wgetopts = ""; my $status; $wgetopts .= " $config{wgetopts}" if $config{wgetopts}; $wgetopts .= " --execute cache=off" if ( $config{catalog_not_cached} eq "true" ); print "=> Fetching new catalog and descriptions ($url) if available ...\n"; myexit( "Option -n selected, stopping here.", "", 0 ) if $nomod; my $desc_file = $filename; $desc_file =~ s|/catalog\.?|/descriptions\.|; unlink "${filename}.tmp", "${desc_file}.tmp"; if ( $url =~ /^file:/ ) { # file method used, use cp my ($tmpcatsrc) = ( $url =~ /^file:\/(.+)$/ ); $status = system( "/bin/cp", "$tmpcatsrc/catalog", "${filename}.tmp" ); if ($status) { myexit( "\nFetching of catalog failed.", "", 1 ); } else { rename "${filename}.tmp", $filename; } $status = system( "/bin/cp", "$tmpcatsrc/descriptions", "${desc_file}.tmp" ); if ($status) { print "Warning: the descriptions file could not be fetched. The --describe option will not be available.\n" if $status; } else { rename "${desc_file}.tmp", $desc_file; } } else { # http/ftp used, use wget locate_wget() unless ( -x $wget ); # If wget disappeared locate alt. logoutput(); $status = system( "$wget", split( ' ', $wgetopts ), "-O", "${filename}.tmp", "$url/catalog" ); if ($status) { logfail(); myexit( "\nFetching of catalog failed.", "", 1 ); } else { logend(); rename "${filename}.tmp", $filename; } logoutput(); $status = system( "$wget", split( ' ', $wgetopts ), "-O", "${desc_file}.tmp", "$url/descriptions" ); if ($status) { logfail(); print "Warning: the descriptions file could not be fetched. The --describe option will not be available" if $status; } else { logend(); rename "${desc_file}.tmp", $desc_file; } } system( "/bin/touch", $filename ) if ( -w $filename ); } # Get wanted package and its dependencies # pkglist - packages to fetch # mode - 4 = stream silent sub fetch_pkgs { my ( $mode, @pkglist ) = @_; my $wgetopts = ""; my ( $file, $status ); my $FH = ( $mode == 4 ? *STDERR : *STDOUT ); if ( scalar(@pkglist) > 1 && !$yes ) { print scalar(@pkglist), " packages to fetch. Do you want to continue? ([y],n,auto) "; chomp( my $prompt = ); if ( $prompt =~ /^[nN]/ ) { myexit( "", "", 0 ); } elsif ( $prompt =~ /^a(uto)*/i ) { print "Turning on automatic mode as if --yes was passed.\n"; $yes = 1; } } $wgetopts .= " $config{wgetopts}" if $config{wgetopts}; my $i = 1; foreach my $pkg (@pkglist) { $file = parse_catalog( $pkg, 3 ); if ( -r "$pkgdir/$file" && -s _ != parse_catalog( $pkg, 5 ) ) { # Broken/empty files may be present print $FH "Removing non-matching local file for $pkg.\n"; unlink "$pkgdir/$file"; } if ( -r "$pkgdir/$file" ) { $i++; print $FH "A local copy of $pkg exists and is of matching size.\n"; } else { print $FH "=> Fetching $pkg (" . $i++ . "/" . scalar(@pkglist) . ") ...\n"; locate_wget() unless ( -x $wget ); # If wget disappeared locate alt. logoutput(); my $tried; foreach ( @{ $pkgmirror{$file} } ) { $tried = 1; unlink "$pkgdir/${file}.tmp"; if ( $_ =~ /^file:/ ) { my ($tmpcatsrc) = ( $_ =~ /^file:\/(.+)$/ ); run_hooks( "prefetch", "$tmpcatsrc/$file", $pkg ); $status = system( "/bin/cp", "$tmpcatsrc/$file", "$pkgdir/${file}.tmp" ); } else { run_hooks( "prefetch", "$_/$file", $pkg ); $status = system( "$wget", split( ' ', $wgetopts ), "-O", "$pkgdir/${file}.tmp", "$_/$file" ); } unless ($status) { run_hooks( "postfetch", "$_/$file", $pkg ); last; } } if ( $status || !$tried ) { logfail(); myexit( "\nFetching of $pkg failed. Try updating your catalog with pkgutil -U.", "", 1 ); } else { logend(); rename "$pkgdir/${file}.tmp", "$pkgdir/$file"; } } md5( $pkg, "$pkgdir/$file", $mode ) if $use_md5; } } # Find files in package (-F) sub find_file { my $contents = "/var/sadm/install/contents"; # Flush the pkgserv cache if ( -x "/usr/bin/pkgadm" ) { system("/usr/bin/pkgadm sync > dev/null 2>&1"); } foreach (@ARGV) { my $FILE = gensym(); open( $FILE, "<$contents" ) or myexit( "Can't open $contents", "$!", 1 ); while ( my $line = <$FILE> ) { chomp $line; my ( $file, $pkg ) = ( $line =~ /^(.+?)\s.+\s(.+)$/ ); ($file) = ( $file =~ /^(.+)=/ ) if ( $file =~ /=/ ); print "$file\t$pkg\n" if ( $file =~ /\Q$_\E/ ); } close $FILE; } myexit( "", "", 0 ); } # Format size in bytes to more human friendly format with suffixes # size - size in bytes sub format_byte { my ($size) = @_; my $suffix = "B"; if ( $size > 1024 ) { $size /= 1024; $suffix = "KB"; } if ( $size > 1024 ) { $size /= 1024; $suffix = "MB"; } if ( $size > 1024 ) { $size /= 1024; $suffix = "GB"; } return sprintf( "%1.1f %s", $size, $suffix ); } # Get which distribution a package is in # package - package to check sub get_dist { my ($package) = @_; my $file = parse_catalog( $_, 3 ); my @catalog = ( @{ $pkgmirror{$file} } ); #my ($dist) = ($catalog[0] =~ /^.*\/(\S+)\/[i386|sparc]/); # show last part my ($dist) = ( $catalog[0] =~ /^.*\/(\S+\/\S+)\/[i386|sparc]/ ); # show two last parts print STDERR "DEBUG:dist:$dist\n" if $debug; return $dist; } # Check signature on catalog # catalog - filename of catalog to gpg check # parse - silence output if set sub gpg { my ( $catalog, $parse ) = @_; my $line; my $gpg_signed_catalog = 0; if ( !-x "/opt/csw/bin/gpg" ) { myexit( "GPG not found! Install CSWgnupg (pkgutil -i CSWgnupg) or disable use_gpg in pkgutil.conf.", "", 1 ); } my $CATALOG = gensym(); open( $CATALOG, "<$catalog" ) or myexit( "Can't open $catalog", "$!", 1 ); while ( $line = <$CATALOG> ) { $gpg_signed_catalog = 1 if ( $line =~ /-BEGIN PGP SIGNED MESSAGE-/ ); last; } close $CATALOG; print STDERR "DEBUG:GPG catalog: $gpg_signed_catalog\n" if $debug; if ($gpg_signed_catalog) { print "Checking integrity of $catalog with gpg.\n" unless $parse; my $gpghomedir = ""; if ( $config{gpg_homedir} ) { $gpghomedir = "--homedir $config{gpg_homedir}"; } else { if ( check_pkg( "CSWcswpki", 0 ) eq "notinst" ) { $gpghomedir = ""; } else { $gpghomedir = "--homedir /var/opt/csw/pki"; } } my $status = system( "/opt/csw/bin/gpg", split( ' ', $gpghomedir ), "--verify", "$catalog" ); print STDERR "DEBUG:GPG signature: " . ( ($status) ? "Bad" : "Good" ) . "\n" if $debug; myexit( "Bad signature detected in catalog!", "", 1 ) if $status; rename( $catalog, $catalog . ".asc" ) or myexit( "Could not rename catalog!", "", 1 ); $status = system("/opt/csw/bin/gpg $gpghomedir $catalog.asc 2> /dev/null"); myexit( "Catalog signature is not correct!", "", 1 ) if $status; rename( $catalog . ".asc", $catalog ) or myexit( "Could not rename catalog!", "", 1 ); print STDERR "DEBUG:Status GPG: $status\n" if $debug; # Save catalog signer my $gpgoutput = `/opt/csw/bin/gpg $gpghomedir --verify $catalog 2>&1`; ( $catinfo{$catalog}{gpg} ) = ( $gpgoutput =~ /^gpg: .+ signature from (.+)$/m ); } else { myexit( "Catalog $catalog is not signed! Check your mirror settings or disable use_gpg in pkgutil.conf.", "", 1 ); } } # Initialize (note that this section is before options are parsed so # -D does not work here. Set debug to 1 at top of script) # conf - custom configuration # param - configuration overrides sub init { my ( $conf, @param ) = @_; my @conf_file; if ($conf) { @conf_file = ($conf); } else { @conf_file = ( "/opt/csw/etc/pkgutil.conf", "/etc/opt/csw/pkgutil.conf" ); } %config = ( "mirror" => [], "pkgaddopts" => "", "pkgrmopts" => "", "wgetopts" => "", "use_gpg" => "", "use_md5" => "", "pkgliststyle" => "2", "maxpkglist" => "", "noncsw" => "", "stop_on_hook_soft_error" => "", "exclude_pattern" => "", "gpg_homedir" => "", "root_path" => "", "deptree_filter_common" => "", "show_current" => "true", "catalog_not_cached" => "true", "catalog_update" => "14" ); foreach my $file (@conf_file) { if ( -r $file ) { # If conf file found, parse it print STDERR "DEBUG:Conf file: $file\n" if $debug; my $CONFIG = gensym(); open( $CONFIG, "<$file" ) or myexit( "Can't open $file", "$!", 1 ); while (<$CONFIG>) { chomp; # Remove newline s/#.*//; # Remove comments s/^\s+//; # Remove leading white s/\s+$//; # Remove trailing white next unless length; # Next if nothing left my ( $var, $value ) = split( /\s*=\s*/, $_, 2 ); unless ( exists $config{$var} ) { print "Unrecognized option (in $file): $var\n"; next; } print STDERR "DEBUG:Config:Found $var = $value\n" if $debug; my $r = ref( $config{$var} ); if ( !$r ) { $config{$var} = $value; } elsif ( $r eq 'ARRAY' ) { if ( grep { /^$value$/ } @{ $config{$var} } ) { print STDERR "Duplicate mirror definition skipped ($value).\n"; } else { push( @{ $config{$var} }, $value ); } } } close $CONFIG; } } # Configuration overrides using -p foreach (@param) { if (/mirror/) { print STDERR "Do not use -p for mirror, use -t instead!\n"; next; } my ( $var, $value ) = split(/:/); unless ( exists $config{$var} ) { print "Unrecognized option (using --param): $var\n"; next; } my $r = ref( $config{$var} ); if ( !$r ) { $config{$var} = $value; } elsif ( $r eq 'ARRAY' ) { push( @{ $config{$var} }, $value ); } } if ($debug) { foreach ( sort keys %config ) { print STDERR "DEBUG:$_: " . ( ( $_ eq "mirror" ) ? join( " ", @{ $config{$_} } ) : $config{$_} ) . "\n"; } } $pkgliststyle = $config{pkgliststyle} if defined $config{pkgliststyle}; $maxpkglist = $config{maxpkglist} if $config{maxpkglist}; $use_md5 = $use_gpg = $noncsw = 0; $use_md5 = 1 if ( $config{use_md5} eq "true" ); $use_gpg = 1 if ( $config{use_gpg} eq "true" ); $noncsw = 1 if ( $config{noncsw} eq "true" || $config{noncsw} eq "yes" ); } # Install local packages # pkglist - packages to install sub inst_loc_pkgs { my @pkglist = @_; my $pkgadd = "/usr/sbin/pkgadd"; my $pkgaddopts = ""; my $pkgrm = "/usr/sbin/pkgrm"; my $pkgrmopts = ""; my $pkginfo = "/bin/pkginfo"; my $pkgtrace = ""; my $file; $pkgaddopts .= " $config{pkgaddopts}" if $config{pkgaddopts}; $pkgrmopts .= " $config{pkgrmopts}" if $config{pkgrmopts}; $pkgtrace = "-v" if $trace; my $root_path = $config{root_path} ? "-R $config{root_path}" : ""; foreach (@pkglist) { my $pkgforce = ""; $pkgforce = "-a $admin -n" if ( $yes && -r $admin ); print "\n=> Installing $_\n"; $file = $_; if ( $_ =~ /\.gz$/ ) { # Not all packages are compressed my $status = locate_gzip(); ($file) = ( $file =~ /(.+)\.gz$/ ); if ( !$status ) { if ($yes) { `$gzip -c -f -d $_ > $file`; } else { `$gzip -c -d $_ > $file`; } } else { myexit( "\nGzip not found, please install CSWgzip.", "", 1 ); } } # Remove first if the package is already installed my $pkgname = `$pkginfo $root_path -d $file`; ($pkgname) = ( $pkgname =~ /\s(.+?)\s/ ); my $tmp = check_pkg( $pkgname, 0 ); if ( $tmp ne "notinst" ) { print "\n=> Removing currently installed $pkgname\n"; system( "$pkgrm", split( ' ', $root_path ), split( ' ', $pkgforce ), split( ' ', $pkgtrace ), split( ' ', $pkgrmopts ), "$pkgname" ); } # Install system( "$pkgadd", split( ' ', $root_path ), split( ' ', $pkgforce ), split( ' ', $pkgtrace ), split( ' ', $pkgaddopts ), "-d", "$file" ); # Check if pkgadd operation exited successfully if ( $? != 0 ) { # If failed pkgadd op and --yes used, exit immediately myexit( "Exiting pkgutil due to pkgadd error", $? >> 8, 1 ) if $yes; printf "\npkgadd failed with exit code: %d\n", $? >> 8; print "Exit from pkgutil and fix this issue first (recommended)? ([y],n) "; chomp( my $prompt = ); myexit( "Exiting pkgutil", "", 1 ) if ( $prompt !~ /^[nN]/ ); } if ( $_ =~ /\.gz$/ ) { # Not all packages are compressed unlink "$file" or myexit( "Can't delete $file", "$!", 1 ); } } myexit( "", "", 0 ); } # Install packages # batchmode - whether we're updating some of the packages or doing new # installs only (values: upgrade or install) # updlistlen - number of packages to update # pkglist - packages to install sub inst_pkgs { my $batchmode = shift; my $updlistlen = shift; my @pkglist = @_; my $tmp = ""; my $pkgadd = "/usr/sbin/pkgadd"; my $pkgaddopts = ""; my $pkgrm = "/usr/sbin/pkgrm"; my $pkgrmopts = ""; my $pkgtrace = ""; my $pkgask = ""; my %upg_pkglist; my ( $file, $name ); $pkgaddopts .= " $config{pkgaddopts}" if $config{pkgaddopts}; $pkgrmopts .= " $config{pkgrmopts}" if $config{pkgrmopts}; $pkgtrace = "-v" if $trace; my $root_path = $config{root_path} ? "-R $config{root_path}" : ""; run_hooks( "prebatch$batchmode", @pkglist ); # Handle pkgutil as a special case, always complete pkgutil upgrade # before proceeding with rest of list if ( scalar(@pkglist) > 1 ) { if ( my @tmplist = grep { /^CSWpkgutil-/ } @pkglist ) { print "\n=> Updating pkgutil first ...\n"; @pkglist = grep { !/^CSWpkgutil-/ } @pkglist; $updlistlen--; inst_pkgs( 'upgrade', 1, $tmplist[0] ); } } # Removing old version of all packages being upgraded my $i = 1; foreach ( reverse @pkglist ) { my $pkgforce = ""; $pkgforce = "-a $admin -n" if ( $yes && -r $admin ); my ($pkgname) = ( $_ =~ /^(.+)-/ ); $tmp = check_pkg( $pkgname, 0 ); if ( $tmp ne "notinst" ) { # A small sanity check myexit( "Batch hook 'install' was run, but we've found a package being upgraded. Bailing out.", "", 1 ) if ( $batchmode eq 'install' ); $upg_pkglist{$_} = 1; run_hooks( "preupgrade", $_ ); print "\n=> Removing old version of $pkgname (" . $i++ . "/" . $updlistlen . ") ...\n"; system( "$pkgrm", split( ' ', $root_path ), split( ' ', $pkgforce ), split( ' ', $pkgtrace ), split( ' ', $pkgrmopts ), "$pkgname" ); } } # Install all packages being upgraded/installed $i = 1; foreach (@pkglist) { my $pkgforce = ""; $pkgforce = "-a $admin -n" if ( $yes && -r $admin ); $file = parse_catalog( $_, 3 ); $name = parse_catalog( $_, 2 ); print "\n=> Installing $_ (" . $i++ . "/" . scalar(@pkglist) . ") ...\n"; if ( $file =~ /\.gz$/ ) { # Not all packages are compressed my $status = locate_gzip(); if ( !$status ) { if ($yes) { `$gzip -f -d $pkgdir/$file`; } else { `$gzip -d $pkgdir/$file`; } } else { myexit( "\nGzip not found, please install CSWgzip.", "", 1 ); } ($file) = ( $file =~ /(.+)\.gz$/ ); } # We may have already run preupgrade above. Running upgrade _and_ install # is invalid run_hooks( "preinstall", $_ ) unless ( defined $upg_pkglist{$_} && $upg_pkglist{$_} == 1 ); # Support response (pkgask) files $pkgask = ( -r "$workdir/pkgask/$name" ) ? "-r $workdir/pkgask/$name" : ""; print STDERR "DEBUG:pkgask: $pkgask\n" if $debug; # Install system( "$pkgadd", split( ' ', $root_path ), split( ' ', $pkgforce ), split( ' ', $pkgtrace ), split( ' ', $pkgask ), split( ' ', $pkgaddopts ), "-d", "$pkgdir/$file", "$name" ); # Check if pkgadd operation exited successfully if ( $? != 0 ) { # If failed pkgadd op and --yes used, exit immediately myexit( "Exiting pkgutil due to pkgadd error", $? >> 8, 1 ) if $yes; printf "\npkgadd failed with exit code: %d\n", $? >> 8; print "Exit from pkgutil and fix this issue first (recommended)? ([y],n) "; chomp( my $prompt = ); myexit( "Exiting pkgutil", "", 1 ) if ( $prompt !~ /^[nN]/ ); } unlink "$pkgdir/$file" or myexit( "Can't delete $pkgdir/$file", "$!", 1 ); if ( defined $upg_pkglist{$_} && $upg_pkglist{$_} == 1 ) { run_hooks( "postupgrade", $_ ); } else { run_hooks( "postinstall", $_ ); } } run_hooks( "postbatch$batchmode", @pkglist ); } # Install (-i) option # mode - 0 = install, 1 = download only, 2 = remove, 3 = stream, # 4 = stream silent, 5 = extract # deps - option --nodeps set or not # parse - option --parse set or not sub install { my ( $mode, $deps, $parse ) = @_; my $retvalue; my ( @tmppkglist, @revpkglist, @newpkglist, @instpkglist, @updpkglist, @curpkglist, @dlpkglist ); my $FH = ( $mode == 4 ? *STDERR : *STDOUT ); my ( %pkgvers, @pkglist, @excludelist ) ; # @pkglist is specifically in the correct order my $root_path = $config{root_path} ? "-R $config{root_path}" : ""; my $pkgrmopts = ""; $pkgrmopts = "$config{pkgrmopts}" if $config{pkgrmopts}; print $FH "Solving needed dependencies ...\n" unless ( $deps || $parse ); foreach my $tmppkg (@ARGV) { my $tmp = parse_catalog( $tmppkg, 2 ); my $vers = parse_catalog( $tmppkg, 1 ); if ( $tmp ne 'not in catalog' && ( $tmp =~ /^CSW/ || $noncsw ) ) { push( @pkglist, $tmp ); $pkgvers{$tmp} = $vers; } else { myexit( "Package $tmppkg not in catalog. Exiting.", "", 1 ); } } unless ($deps) { # Skip adding dependencies? (option --nodeps) my %finished; foreach my $tmppkg2 (@pkglist) { # N.B. This array grows and we keep looping until we've satisfied all # of the dependencies print STDERR "DEBUG:Loop #", scalar(@pkglist), " (limit $maxpkglist)\n" if $debug; my @tmpdeps; # Next two lines from Joe Baro reduces iterations next if $finished{$tmppkg2}; $finished{$tmppkg2} = 1; if ( $tmppkg2 ne "CSWcommon" ) { $retvalue = parse_catalog( $tmppkg2, 6 ); if ( $retvalue eq "not in catalog" ) { system( "/bin/pkginfo", split( ' ', $root_path ), "-q", "$tmppkg2" ); if ( $? == 0 ) { # Already installed...forgive its absence from the catalog print STDERR "Warning: $tmppkg2 not in catalog.\n"; next; } else { myexit( "Package $tmppkg2 not in catalog. Exiting.", "", 1 ); } } else { @tmpdeps = split( /\|/, $retvalue ); print STDERR "DEBUG:depmap: $tmppkg2 -> ", $retvalue, "\n" if $debug; } } else { next; } if ( $tmpdeps[0] ne "none" && $tmpdeps[0] ne "not in catalog" ) { foreach my $dep (@tmpdeps) { # There is no support for dependencies against a particular version, e.g. CSWzope-3.3.1, just CSWzope if ( !exists $pkgvers{$dep} ) { $pkgvers{$dep} = parse_catalog( $dep, 1 ); } push( @pkglist, $dep ) ; # Append to list, does not include deduplication } } next; } } print STDERR "DEBUG:pkglist ", join( ",", @pkglist ), "\n" if $debug; # Now reverse and deduplicate @pkglist. Need the last instance of each # package if reading @pkglist forwards my @tmprevpkglist = dedup( reverse @pkglist ); foreach (@tmprevpkglist) { push( @revpkglist, $_ ) if $pkgvers{$_}; # Not if excluded } if ( $mode == 2 ) { # If -r used if ( scalar(@revpkglist) > 0 ) { my @rmpkgs = (); foreach my $p (@revpkglist) { push( @rmpkgs, "$p-" . $pkgvers{$p} ); } remove( reverse @rmpkgs ); } } print STDERR "DEBUG:revpkglist: " . scalar(@revpkglist) . "\n", join( ",", @revpkglist ), "\n" if $debug; print STDERR "DEBUG:Loop #", scalar(@pkglist), " (limit $maxpkglist)\n" if $debug; unless ($deps) { print $FH "Solving dependency order ...\n" unless $parse; my @revpkglist2 = @revpkglist; my @revpkglist3; foreach (@revpkglist2) { if ( scalar(@revpkglist2) > $maxpkglist ) { print "Loop protection limit ($maxpkglist iterations) hit. There's probably a\ncyclic dependency in the catalog.\n"; print "Do you want to continue anyway? ([y],n) "; chomp( my $prompt = ); myexit( "", "", 0 ) if ( $prompt =~ /^[nN]/ ); @revpkglist3 = dedup(@revpkglist2); last; } my $dep = parse_catalog( $_, 6 ); if ( $dep eq "none" || $dep eq "not in catalog" ) { push( @revpkglist3, $_ ); } else { my $allhit = 1; foreach my $i ( split( /\|/, $dep ) ) { my $hit = 0; foreach my $j (@revpkglist3) { if ( $i eq $j ) { $hit = 1; last; } } if ( !$hit ) { # no hit, add last for re-processing push( @revpkglist2, $_ ); $allhit = 0; last; } } if ($allhit) { # all deps ok, add to final list push( @revpkglist3, $_ ); } } } print STDERR "DEBUG:revpkglist3: " . scalar(@revpkglist3) . "\n", join( ",", @revpkglist3 ), "\n" if $debug; @revpkglist = @revpkglist3; } # Clean list from command line exclude patterns foreach my $pattern (@exclude) { my @tmppkglist = grep { !/$pattern/ } @revpkglist; push( @excludelist, grep { /$pattern/ } @revpkglist ); @revpkglist = @tmppkglist; } # Clean list from exclude patterns in pkgutil.conf foreach my $pattern ( split( /\s+?/, $config{exclude_pattern} ) ) { my @tmppkglist = grep { !/$pattern/ } @revpkglist; push( @excludelist, grep { /$pattern/ } @revpkglist ); @revpkglist = @tmppkglist; } # Incompatible packages (I-dependencies) my @ideppkglist; foreach (@revpkglist) { my $retvalue = parse_catalog( $_, 8 ); push( @ideppkglist, split( /\|/, $retvalue ) ) if ( $retvalue ne "none" ); } # Clean the list from packages not installed my @ideppkglist2; foreach (@ideppkglist) { # Check if pkg is present first push( @ideppkglist2, $_ ) if ( check_pkg( $_, 0 ) ne "notinst" ); } @ideppkglist = @ideppkglist2; undef @ideppkglist2; # Which packages do we really need to download? if ( $mode == 0 || $mode == 2 ) { foreach (@revpkglist) { my $old = check_pkg( $_, 0 ); my $new = $pkgvers{$_}; if ( $old eq "notinst" ) { # New package needed push( @newpkglist, "$_-$new" ); } else { # Package already installed my $cmpval = verscmp( $new, $old ); if ( $cmpval == 1 || ( $cmpval != 0 && $force ) ) { # Older or --force push( @updpkglist, "$_-$new" ); # Updated package needed } else { push( @curpkglist, "$_-$old" ); # Package is current } } } } else { # If -s or --extract then just copy revpkglist to newpkglist foreach (@revpkglist) { push( @newpkglist, "$_-$pkgvers{$_}" ); } } my $pkgsep = ( $pkgliststyle ? "\n\t" : " " ); # Only present updated and current packages when doing install/upgrade if ( $mode == 0 ) { if ( scalar(@curpkglist) > 0 && $config{show_current} eq "true" ) { print scalar(@curpkglist) . " CURRENT packages:$pkgsep", join( "$pkgsep", sort @curpkglist ), "\n"; } if ( scalar(@updpkglist) > 0 ) { print "Install " . scalar(@updpkglist) . " UPDATED packages"; if ( $pkgliststyle == 2 ) { foreach ( sort @updpkglist ) { print "$pkgsep$_ (" . get_dist($_) . ")"; } print "\n"; } else { print $FH ":$pkgsep", join( "$pkgsep", sort @updpkglist ), "\n"; } } } # Different text for install/upgrade vs. the rest if ( scalar(@newpkglist) > 0 ) { print $FH ( $mode == 0 ) ? "Install " . scalar(@newpkglist) . " NEW packages:" : "Package list:" unless $parse; if ( $pkgliststyle == 2 || $parse ) { foreach ( sort @newpkglist ) { if ($parse) { # parse mode to display catalog name, catalog and md5 print parse_catalog( $_, 0 ) . "\t" . get_dist($_) . "\t" . parse_catalog( $_, 4 ) . "\n"; } else { print "$pkgsep$_ (" . get_dist($_) . ")"; } } print "\n" unless $parse; } else { print $FH "$pkgsep", join( "$pkgsep", sort @newpkglist ), "\n"; } } # Only present incompatible packages when doing install/upgrade if ( $mode == 0 ) { if ( scalar(@ideppkglist) > 0 ) { print "Remove " . scalar(@ideppkglist) . " INCOMPATIBLE packages:$pkgsep", join( "$pkgsep", sort @ideppkglist ), "\n"; } } # Show excluded packages if ( scalar(@excludelist) > 0 ) { print $FH scalar(@excludelist) . " EXCLUDED packages:$pkgsep", join( "$pkgsep", sort @excludelist ), "\n"; } # What packages do we need to fetch? # Make sure they are in correct order foreach my $i (@revpkglist) { my $hit = 0; foreach (@curpkglist) { my ($j) = ( $_ =~ /^(.+)-/ ); if ( $i eq $j ) { $hit = 1; print STDERR "DEBUG:i: $i j: $j hit: $hit\n" if $debug; last; } print STDERR "DEBUG:i: $i j: $j hit: $hit\n" if $debug; } my $tmp = "$i-$pkgvers{$i}"; push( @dlpkglist, $tmp ) unless $hit; } print STDERR "DEBUG:dlpkglist: " . scalar(@dlpkglist) . "\n", join( ",", @dlpkglist ), "\n" if $debug; # Print info before exiting if there's nothing to do myexit( "\nNothing to do.", "", 0 ) if ( scalar(@dlpkglist) == 0 ); # Print size of download if ( scalar(@dlpkglist) > 0 && $parse == 0 ) { foreach (@dlpkglist) { $size += parse_catalog( $_, 5 ); } print $FH "Total size: " . format_byte($size) . "\n"; } myexit( "", "", 0 ) if $parse; myexit( "Option -n selected, stopping here.", "", 0 ) if $nomod; if ( scalar(@dlpkglist) > 0 ) { fetch_pkgs( $mode, @dlpkglist ); } # Display a list of files when downloading if ( $mode == 1 ) { print "\nPackages downloaded to $pkgdir:\n"; foreach (@dlpkglist) { my $file = parse_catalog( $_, 3 ); print "$file"; $file = "$pkgdir/$file"; print " (OK)\n" if ( -s $file ); print " (empty)\n" if ( -z $file ); print " (missing)\n" if ( !-e $file ); } } extract_pkg(@dlpkglist) if ( $mode == 5 ); # --extract return @revpkglist if ( $mode == 3 || $mode == 4 ); # If -s used # Warn if cswclassutils is in the install list and we have a # read-only /usr/sadm/install/scripts dir if ( grep { /^CSWcas-/ } @dlpkglist ) { # CAS pkg in the list? if ( ! -w "/usr/sadm/install/scripts" && $mode == 0 ) { # /usr ro? myexit( "A class action script is about to be installed but\n" . "/usr/sadm/install/scripts is read-only so it will fail.\n" . "If you're running a sparse zone, please install/update the\n" . "class action scripts from the global zone. If you want to\n" . "proceed with this installation you have to exclude the\n" . "CAS package (use the -x option). Exiting.", "", 1 ); } } # Remove incompatible packages if ( scalar(@ideppkglist) > 0 && $mode == 0 ) { my $pkgrm = "/usr/sbin/pkgrm"; my $pkgtrace = ""; my $pkgforce = ""; if ( !$yes ) { print scalar(@ideppkglist), " incompatible package" . ( scalar(@ideppkglist) > 1 ? "s" : "" ) . " to remove. Do you want to continue? ([y],n,auto) "; chomp( my $prompt = ); if ( $prompt =~ /^[nN]/ ) { myexit( "", "", 0 ); } elsif ( $prompt =~ /^a(uto)*/i ) { print "Turning on automatic mode as if --yes was passed.\n"; $yes = 1; } } $pkgforce = "-a $admin -n" if ( $yes && -r $admin ); foreach (@ideppkglist) { print "\n=> Removing incompatible package $_\n"; system( "$pkgrm", split( ' ', $root_path ), split( ' ', $pkgforce ), split( ' ', $pkgtrace ), split( ' ', $pkgrmopts ), "$_" ); } } if ( $mode == 0 ) { # If -d not used, install if ( scalar(@dlpkglist) > 0 ) { inst_pkgs( scalar(@updpkglist) ? 'upgrade' : 'install', scalar(@updpkglist), @dlpkglist ); } } myexit( "", "", 0 ); } # List dependencies (part of --cleanup) sub list_deps { my $pkgdir = $config{root_path} ? "$config{root_path}/var/sadm/pkg" : "/var/sadm/pkg"; my %deps; chdir($pkgdir) or myexit( "Could not cd to $pkgdir", "", 1 ); foreach ( glob("CSW*") ) { if ( -r "$_/install/depend" ) { my $FILE = gensym(); open( $FILE, "<$_/install/depend" ); while (<$FILE>) { chomp; if (/^P\s+\S/) { my ($deptmp) = (/P\s+(\S+)/); $deps{$deptmp} = 1 if ( $deptmp ne $_ && $deptmp !~ /^SUNW/ ) ; # Skip if circular or SUNW } } close $FILE; } } my @deps = sort keys %deps; return @deps; } # List files in package (-L) sub list_file { my $contents = $config{root_path} ? "$config{root_path}/var/sadm/install/contents" : "/var/sadm/install/contents"; # Flush the pkgserv cache if ( -x "/usr/bin/pkgadm" ) { system( "/usr/bin/pkgadm" . ( $config{root_path} ? " -R " . $config{root_path} : "" ) . " sync > /dev/null 2>&1" ); } foreach (@ARGV) { if ( -r $_ && -f _ ) { # Argument is a package file if ( $_ =~ /\.pkg$/ ) { my (@tmp) = `/usr/sbin/pkgchk -l -d $_ all`; foreach (@tmp) { next unless ( $_ =~ /^Pathname:\s\// ); my ($file) = ( $_ =~ /^Pathname:\s(.+?)\s/ ); ($file) = ( $file =~ /^(.+)=/ ) if ( $file =~ /=/ ); print "$file\n"; } } else { print "Package file name ($_) must end in .pkg\n"; next; } } else { # Argument is a package name my $tmp; if ( $_ =~ /^[A-Z]/ ) { $tmp = $_; } else { $tmp = parse_catalog( $_, 2 ); } my $FILE = gensym(); open( $FILE, "<$contents" ) or myexit( "Can't open $contents", "$!", 1 ); while ( my $line = <$FILE> ) { chomp $line; my ( $file, $pkg ) = ( $line =~ /^(.+?)\s.+\s(.+)$/ ); ($file) = ( $file =~ /^(.+)=/ ) if ( $file =~ /=/ ); print "$file\n" if ( $pkg eq $tmp ); } close $FILE; } } myexit( "", "", 0 ); } # List obsolete files (part of --cleanup) sub list_obsolete { my $pkgdir = $config{root_path} ? "$config{root_path}/var/sadm/pkg" : "/var/sadm/pkg"; my @legacy; chdir($pkgdir) or myexit( "Could not cd to $pkgdir", "", 1 ); foreach ( glob("CSW*") ) { push( @legacy, $_ ) if ( -e "$_/install/obsolete" ); } return @legacy; } # List installed packages (-l) sub list_pkgs { my $pkgdir = $config{root_path} ? "$config{root_path}/var/sadm/pkg" : "/var/sadm/pkg"; chdir($pkgdir) or myexit( "Could not cd to $pkgdir", "", 1 ); foreach ( $noncsw ? glob("*") : glob("CSW*") ) { if ( scalar(@ARGV) > 0 ) { foreach my $arg (@ARGV) { print "$_\n" if ( $_ =~ /$arg/ ); } } else { print "$_\n"; } } myexit( "", "", 0 ); } # Find gzip sub locate_gzip { my @locations = ( "/opt/csw/bin", "/bin", "/usr/local/bin" ); foreach (@locations) { if ( -x "$_/gzip" ) { next if check_binary("$_/gzip"); $gzip = "$_/gzip"; last; } } print STDERR "DEBUG:gzip: $gzip\n" if $debug; return 1 if ( !$gzip ); } # Find wget sub locate_wget { my @locations = ( "/opt/csw/bin", "/usr/sfw/bin", "/usr/local/bin", "/usr/bin" ); my $libexec = "/opt/csw/libexec/pkgutil"; foreach (@locations) { if ( -x "$_/wget" ) { next if check_binary("$_/wget"); $wget = "$_/wget"; last; } } # Check for wget binary included in pkgutil package if ( !$wget ) { chomp( my $loc_arch = `uname -p` ); # Arch type sparc|i386 $wget = "$libexec/wget-$loc_arch" if ( -x "$libexec/wget-$loc_arch" ); } if ( !$wget ) { $wget = "$libexec/wget" if ( -x "$libexec/wget" ); } print STDERR "DEBUG:wget: " . ( $wget ? $wget : "-" ) . "\n" if $debug; return 1 if ( !$wget ); } # These three routines are used to capture the output of sub processes into a # log file. If the command completes successfuly, the log file is thrown away. # If the command fails, the log file is printed along with an error message by # calling logfail. sub logoutput { my ( $fh ); eval { require File::Temp; }; # Check for File::Temp if ( $@ ) { $logfile = "/tmp/pkgutil.$$.log.$^T"; } else { ( $fh, $logfile ) = File::Temp::tempfile( DIR => "/tmp" ); } open( OLDOUT, '>&STDOUT' ); open( OLDERR, '>&STDERR' ); open( STDOUT, "> $logfile" ); open( STDERR, "> $logfile" ); } sub logend { # Reference fh to silence warning select( OLDERR ); select( OLDOUT ); # Restore output. select( STDOUT); close( STDOUT ); open( STDOUT, ">&OLDOUT" ); close( STDERR ); open( STDERR, ">&OLDERR" ); unlink( $logfile ); } sub logfail { close( STDOUT ); open( STDOUT, ">&OLDOUT" ); close( STDERR ); open( STDERR, ">&OLDERR" ); open( LOG, "< $logfile" ) or die "pkgutil: Error, @_ - can't open log\n"; print ; close( LOG ); unlink( $logfile ); } # Make a filename from the URL - /es to _es # url - url to mangle sub mangle_url { my ($url) = @_; ( my $mangled = $url ) =~ s?\w+://??; $mangled =~ s?/?_?g; my $filename = "$workdir/catalog.$mangled"; return $filename; } # Check md5 on downloaded files # mode - 4 = stream silent sub md5 { my ( $pkg, $file, $mode ) = @_; my $md5; my $FH = ( $mode == 4 ? *STDERR : *STDOUT ); eval { require Digest::MD5; }; if ($@) { if ( -x "/opt/csw/bin/gmd5sum" ) { myexit( "Can't open $file", "$!", 1 ) unless ( -r $file ); $md5 = `/opt/csw/bin/gmd5sum $file`; ($md5) = ( $md5 =~ /^(.*\w) / ); } else { myexit( "\nMD5 support not available! Install CSWcoreutils to get MD5\nsupport. Another alternative is to install CSWperl and use\nthat for pkgutil. Do that by having /opt/csw/bin before\n/usr/bin in your path.", "", 1 ); } } else { my $FILE = gensym(); open( $FILE, "<$file" ) or myexit( "Can't open $file", "$!", 1 ); binmode($FILE); $md5 = Digest::MD5->new->addfile($FILE)->hexdigest; close $FILE; } my $md5cat = parse_catalog( $pkg, 4 ); print STDERR "DEBUG:$pkg md5 file: $md5\n$pkg md5 cat: $md5cat\n" if $debug; myexit( "MD5 for $pkg doesn't match catalog!", "", 1 ) if ( $md5 ne $md5cat ); print $FH "MD5 for $pkg matched.\n"; } # Do cleanup and exit with return code # msg - message to stderr # err - error ($!) # rc - return code when exiting sub myexit { my ( $msg, $err, $rc ) = @_; my $text = ( $msg && $err ) ? "$msg: $err" : "$msg"; $rc = 0 unless $rc; unlink $admin if ( $admin && -r $admin && $admin =~ /admin\.run$/ ); print STDERR "$text\n" if $text; exit $rc; } # Parse catalog # pkg - package to look for, can be both common name and true name # mode - what we want to return, field number from catalog sub parse_catalog { my ( $pkg, $mode ) = @_; my ( $retvalue, $name ); print STDERR "DEBUG:Parsing catalog ... looking for: $pkg (mode $mode)\n" if $debug; # Do we have an embedded version? my @p = split /-/, $pkg; my $vers = pop @p; my $tryname = join( '-', @p ); # First check the whole name without stripping off a "version" # e.g. CSWdovecot-devel if ( $pkg{$pkg} ) { # SysV, no version (e.g. CSWdovecot-devel) $name = $pkg; undef $vers; } elsif ( $commonpkg{$pkg} && $pkg{ $commonpkg{$pkg} } ) { # Common (e.g. dovecot_devel) $name = $commonpkg{$pkg}; undef $vers; } elsif ( $pkg{$tryname} ) { # SysV, version (e.g. CSWdovecot-devel-1.0.13,REV=2008.03.16) $name = $tryname; } elsif ( $commonpkg{$tryname} && $pkg{ $commonpkg{$tryname} } ) { # Common (e.g. dovecot_devel-1.0.13,REV=2008.03.16) $name = $commonpkg{$tryname}; } if ($name) { # Have we a version match? if ( $vers && exists $pkg{$name}{$vers} ) { my @tmpcatline = split( / /, $pkg{$name}{$vers} ); my $fieldsincatalog = scalar(@tmpcatline); if ( $mode == 8 && $fieldsincatalog < 9 ) { $retvalue = "none"; } else { $retvalue = ( split( / /, $pkg{$name}{$vers} ) )[$mode]; } } elsif ( !$vers ) { # We may have multiple versions in the catalog, take the highest # Note this won't work unless at least one has a REV in it my $highest = ( sort { verscmp( $b, $a ) } keys %{ $pkg{$name} } )[0]; my @tmpcatline = split( / /, $pkg{$name}{$highest} ); my $fieldsincatalog = scalar(@tmpcatline); if ( $mode == 8 && $fieldsincatalog < 9 ) { $retvalue = "none"; } else { $retvalue = ( split( / /, $pkg{$name}{$highest} ) )[$mode]; } } else { $retvalue = "not in catalog" if ( !$retvalue ); } } else { $retvalue = "not in catalog" if ( !$retvalue ); } print STDERR "DEBUG:Return value: $retvalue\n" if $debug; return $retvalue; } # Parse command line sub parse_cl { my ( $opt_install, $opt_upgrade, $opt_remove, $opt_download, $opt_avail, $opt_compare, $opt_compare_available, $opt_upd_cat, $opt_deptree, $opt_email, @opt_temp, $opt_help, $opt_version, $opt_syscheck, $opt_stream, $opt_target, $opt_output, $opt_workdir, $opt_config, $opt_compare_diffonly, $opt_listfile, $opt_findfile, $opt_describe, $opt_extract, $opt_nodeps, $opt_single, @opt_param, $opt_list, $opt_parse, $opt_cleanup, $opt_pkgdir, $opt_rootpath, $opt_catinfo ); usage() unless scalar(@ARGV); # This call gives hooks a chance to look at the unaltered argument list print STDERR "DEBUG:preargproc: " . join( ' ', @ARGV ) . "\n" if $debug; run_hooks( "preargproc", @ARGV ); $opt_parse = 0; GetOptions( "i|install" => \$opt_install, "u|upgrade" => \$opt_upgrade, "r|remove" => \$opt_remove, "d|download" => \$opt_download, "a|available" => \$opt_avail, "A|compare-avail" => \$opt_compare_available, "describe" => \$opt_describe, "c|compare" => \$opt_compare, "C|compare-diff" => \$opt_compare_diffonly, "config=s" => \$opt_config, "U|catalog" => \$opt_upd_cat, "e|email=s" => \$opt_email, "t|temp=s" => \@opt_temp, "y|yes" => \$yes, "f|force" => \$force, "s|stream" => \$opt_stream, "T|target=s" => \$opt_target, "o|output=s" => \$opt_output, "x|exclude=s" => \@exclude, "W|workdir=s" => \$opt_workdir, "n|nomod" => \$nomod, "D|debug" => \$debug, "trace" => \$trace, "h|help" => \$opt_help, "v|version" => \$opt_version, "l|list" => \$opt_list, "L|listfile" => \$opt_listfile, "F|findfile" => \$opt_findfile, "extract" => \$opt_extract, "single" => \$opt_single, "deptree:i" => \$opt_deptree, "N|nodeps" => \$opt_nodeps, "parse" => \$opt_parse, "p|param=s" => \@opt_param, "cleanup" => \$opt_cleanup, "catinfo" => \$opt_catinfo, "P|pkgdir=s" => \$opt_pkgdir, "R|rootpath=s" => \$opt_rootpath, "V|syscheck" => \$opt_syscheck ) || usage(); # If --deptree was given without an argument set it to 999 $opt_deptree = 999 if ( defined $opt_deptree && $opt_deptree == 0 ); print STDERR "DEBUG:pkgutil version: $pkgutilver\n" if $debug; print STDERR "DEBUG:perl version: $]\n" if $debug; # Simple options usage() if $opt_help; pkgutilver(0) if $opt_version; find_file() if $opt_findfile; $config{root_path} = $opt_rootpath if $opt_rootpath; print STDERR "DEBUG:root_path: $config{root_path}\n" if $debug; # Installing local packages if all args are package files if ( scalar(@ARGV) && ( $opt_install || $opt_upgrade ) ) { my $notalocpkg = 0; foreach (@ARGV) { $notalocpkg = 1 unless ( -r $_ && -s _ && $_ =~ /\.pkg(\.gz)?$/ ); print STDERR "DEBUG:$_ : $notalocpkg\n" if $debug; } unless ($notalocpkg) { print "Installing your local packages ...\n"; inst_loc_pkgs(@ARGV); } } init( $opt_config, @opt_param ) if ( $opt_config || scalar(@opt_param) ); list_pkgs() if $opt_list; pkgutilver(1) if $opt_syscheck; locate_wget(); locate_gzip(); if ($opt_workdir) { # Set/create optional working dir $workdir = $opt_workdir; } elsif ($>) { # If -W not used and non-root, use home dir $workdir = $ENV{HOME} . "/.pkgutil"; if ( !-d $workdir ) { # Create if non-existing my $status = mkdir $workdir, 0777; myexit( "Could not create $workdir", "$!", 1 ) unless $status; } print STDERR "DEBUG:username: " . getpwuid($>) . "\n" if $debug; print STDERR "You're not root and didn't set -W, using home dir.\n"; } print STDERR "DEBUG:workdir: $workdir\n" if $debug; if ($opt_pkgdir) { # Set/create optional package dir $pkgdir = $opt_pkgdir; } else { $pkgdir = "$workdir/packages"; } print STDERR "DEBUG:pkgdir: $pkgdir\n" if $debug; # Create runtime copy of admin to make sure we have one # available even during upgrade of pkgutil itself $admin = "$workdir/admin"; $admin = "/var/opt/csw/pkgutil/admin" unless ( -r $admin ); my $ADMSRC = gensym(); open( $ADMSRC, "<$admin" ) or myexit( "Can't open $admin", "$!", 1 ); if ( -r "$workdir/admin.run" ) { my @pslist = `/bin/ps -ef`; my $pkgutilinst = 0; foreach (@pslist) { $pkgutilinst++ if (/\bperl\s.*pkgutil\b/); } if ( $pkgutilinst > 1 ) { myexit( "Another instance of pkgutil is already running!", "", 1 ); } else { unlink "$workdir/admin.run" if ( -r "$workdir/admin.run" ); print STDERR "Stale lock file ($workdir/admin.run) removed\n"; } } my $ADMCPY = gensym(); open( $ADMCPY, ">$workdir/admin.run" ) or myexit( "Can't open $workdir/admin.run", "$!", 1 ); while (<$ADMSRC>) { print $ADMCPY $_; } close $ADMSRC; close $ADMCPY; $admin = "$workdir/admin.run"; # Read state file if available my $statefile = "$workdir/pkgutil.state"; if ( -r $statefile ) { # If state file found, parse it my $STATE = gensym(); open( $STATE, "<$statefile" ) or myexit( "Can't open $statefile", "$!", 1 ); while (<$STATE>) { chomp; # Remove newline my ( $var, $value ) = split( /=/, $_, 2 ); $state{$var} = $value; print STDERR "DEBUG:State:Found $var = $value\n" if $debug; } close $STATE; } else { print "DEBUG: no state file found\n" if $debug; } # Cleanup supports yes/auto so it needs to have $admin set cleanup() if $opt_cleanup; my $status = system( "/bin/mkdir", "-p", "$pkgdir" ); myexit( "Could not create $pkgdir", "$!", 1 ) if $status; # Get mirrors together @mirror = @{ $config{mirror} }; $mirror[0] = $defaultmirror unless @mirror; # If no mirrors configured # Prepend temp mirrors so they are selected first unshift( @mirror, @opt_temp ) if @opt_temp; my @supp_arch = qw(sparc i386); my @supp_rel = qw(5.8 5.9 5.10 5.11); my ( $ok_arch, $ok_rel ) = ( 0, 0 ); my ( $loc_arch, $loc_rel ); if ( $opt_target && $opt_download ) { if ( $opt_target =~ /.:./ ) { ( $loc_arch, $loc_rel ) = split( /:/, $opt_target ); } else { myexit( "$opt_target is not a correct arch:rel combo", "", 1 ); } } else { chomp( $loc_arch = `uname -p` ); # Arch type sparc|i386 chomp( $loc_rel = `uname -r` ); # OS version, e.g. 5.10 } print STDERR "DEBUG:arch: $loc_arch\nDEBUG:os rel: $loc_rel\n" if $debug; foreach (@supp_arch) { if ( $loc_arch eq $_ ) { $ok_arch = 1; last; } } foreach (@supp_rel) { if ( $loc_rel eq $_ ) { $ok_rel = 1; last; } } print "Architecture $loc_arch not supported.\n" unless $ok_arch; print "OS release $loc_rel not supported.\n" unless $ok_rel; myexit( "", "", 1 ) if ( ( $ok_arch + $ok_rel ) < 2 ); foreach ( my $i = 0 ; $i < scalar(@mirror) ; $i++ ) { ( $mirror[$i] ) = ( $mirror[$i] =~ q!^(.+\w)! ); $mirror[$i] .= "/" . $loc_arch . "/" . $loc_rel; } print STDERR "DEBUG:primary mirror: $mirror[0]\n" if $debug; if ( $opt_upd_cat || @opt_temp ) { check_catalog( 1, $opt_parse ); # Reread everything } else { check_catalog( 0, $opt_parse ); } # Running the hook now should pass only things that remain in ARGV, # which should be a list of package names my @norm_argv; foreach (@ARGV) { push( @norm_argv, parse_catalog( $_, 2 ) ); } print STDERR "DEBUG:postargproc: " . join( ' ', @norm_argv ) . "\n" if $debug; run_hooks( "postargproc", @norm_argv ); # Complex options catalog_info() if $opt_catinfo; list_file() if $opt_listfile; # Download and stream if both -d and -s selected stream( $loc_arch, $loc_rel, $opt_output ) if ( $opt_stream && $opt_download ); email($opt_email) if $opt_email; available( 0, $opt_parse ) if $opt_avail; available( 1, $opt_parse ) if $opt_compare_available; deptree($opt_deptree) if $opt_deptree; describe($opt_parse) if $opt_describe; compare( 3, $opt_parse ) if $opt_compare_diffonly; compare( 4, $opt_parse ) if ( $opt_compare && $opt_single ); compare( 0, $opt_parse ) if $opt_compare; # Download and extract if both -d and --extract selected install( 5, $opt_nodeps, $opt_parse ) if ( $opt_extract && $opt_download ); install( 0, $opt_nodeps, $opt_parse ) if $opt_install; install( 2, $opt_nodeps, $opt_parse ) if $opt_remove; # Remove instead of install install( 1, $opt_nodeps, $opt_parse ) if $opt_download; # Download only # Upgrade is a special case of install if ($opt_upgrade) { if ( scalar(@ARGV) == 0 || $ARGV[0] =~ /all/i ) { # Need to manipulate ARGV to match installed CSW packages # that need upgrading (use -c mode 1) print "Looking for packages that can be upgraded ...\n"; my @cswpkgs = compare( 1, 0 ); my $i = 0; foreach (@cswpkgs) { $ARGV[ $i++ ] = $_; } } install( 0, $opt_nodeps, $opt_parse ); } # Arguments but no options print "You need to select a valid option!\n" if ( !$opt_upd_cat ); } # Show version info (-v/V) # mode - 0 = print only version, 1 = system check sub pkgutilver { my ($mode) = @_; my $flag = 0; chomp( my $solver = `uname -r` ); chomp( my $solarch = `uname -p` ); my ( $pkgpatch, $pkgpatchinst ); if ($mode) { print "- System -\n"; print "Pkgutil\t\t$pkgutilver\n"; print "Arch\t\t$solarch\n"; print "Solaris\t\t$solver\n"; $pkgpatch = ( $solarch eq "sparc" ) ? "110934" : "110935" if ( "$solver" eq "5.8" ); $pkgpatch = ( $solarch eq "sparc" ) ? "113713" : "114568" if ( "$solver" eq "5.9" ); $pkgpatch = ( $solarch eq "sparc" ) ? "119317" : "119318" if ( "$solver" eq "5.10" ); if ( $solver ne "5.11" ) { chomp( $pkgpatchinst = `showrev -p | grep $pkgpatch | cut -d' ' -f2 | grep $pkgpatch | sort | tail -1` ); $pkgpatchinst = ($pkgpatchinst) ? "$pkgpatchinst installed" : "not found"; } else { $pkgpatch = $pkgpatchinst = "na"; } print "Pkg patch\t$pkgpatch ($pkgpatchinst)\n"; if ( -x "/opt/csw/bin/gpg" ) { print "GPG binary\t/opt/csw/bin/gpg\n"; } else { print "GPG binary\tnot found (suggestion: install CSWgnupg)\n"; } my $status = locate_gzip(); print "Gzip binary\t" . ( ($status) ? "not found (suggestion: install CSWgzip)" : $gzip ) . "\n"; if ( -x "/bin/mailx" ) { print "Mailx binary\t/bin/mailx\n"; } else { print "Mailx binary\tnot found (option --email not available)\n"; } if ( -x "/opt/csw/bin/gmd5sum" ) { print "MD5 binary\t/opt/csw/bin/gmd5sum\n"; } else { print "MD5 binary\tnot found"; print " (suggestion: install CSWcoreutils)" unless $flag; print "\n"; $flag = 0; } eval { require Digest::MD5; }; if ($@) { print "MD5 module\tnot found\n"; } else { print "MD5 module\t", Digest::MD5->VERSION, " (primary choice for MD5)\n"; $flag = 1; } print "Perl\t\t$]\n"; print "Perl binary\t" . `which perl`; $status = locate_wget(); print "Wget binary\t" . ( ($status) ? "not found (suggestion: install CSWwget)" : $wget ) . "\n"; print "PATH\t\t$ENV{PATH}\n"; print "\n- Configuration -\n"; print "catalog_not_cached\t$config{catalog_not_cached} (default: true)\n"; print "catalog_update\t\t" . ( ( $config{catalog_update} ) ? $config{catalog_update} : "not set" ) . " (default: 14)\n"; print "deptree_filter_common\t" . ( ( $config{deptree_filter_common} eq "true" ) ? "true" : "false" ) . " (default: false)\n"; print "exclude_pattern\t\t" . ( ( $config{exclude_pattern} ) ? $config{exclude_pattern} : "not set" ) . " (default: none)\n"; print "gpg_homedir\t\t" . ( ( $config{gpg_homedir} ) ? $config{gpg_homedir} : "not set" ) . " (default: none)\n"; print "maxpkglist\t\t$maxpkglist (default: 10000)\n"; print "mirror\t\t\t" . ( ( scalar( @{ $config{mirror} } ) ) ? join( "\n\t\t\t", @{ $config{mirror} } ) : "not set" ) . "\n\t\t\t(default: $defaultmirror)\n"; print "noncsw\t\t\t" . ( ($noncsw) ? $noncsw : "false" ) . " (default: false)\n"; print "pkgaddopts\t\t" . ( ( $config{pkgaddopts} ) ? $config{pkgaddopts} : "not set" ) . " (default: none)\n"; print "pkgliststyle\t\t$pkgliststyle (default: 0)\n"; print "pkgrmopts\t\t" . ( ( $config{pkgrmopts} ) ? $config{pkgrmopts} : "not set" ) . " (default: none)\n"; print "root_path\t\t" . ( ( $config{root_path} ) ? $config{root_path} : "not set" ) . " (default: /)\n"; print "show_current\t\t$config{show_current} (default: true)\n"; print "stop_on_hook_soft_error\t" . ( ( $config{stop_on_hook_soft_error} ) ? $config{stop_on_hook_soft_error} : "not set" ) . " (default: false)\n"; print "use_gpg\t\t\t" . ( ($use_gpg) ? "true" : "false" ) . " (default: false)\n"; print "use_md5\t\t\t" . ( ($use_md5) ? "true" : "false" ) . " (default: false)\n"; print "wgetopts\t\t" . ( ( $config{wgetopts} ) ? $config{wgetopts} : "not set" ) . " (default: none)\n"; } else { print "$pkgutilver\n"; } myexit( "", "", 0 ); } # Read catalog into hash # catalog - catalog to read # filename - filename to use sub read_catalog { my ( $catalog, $filename ) = @_; my @llst; my $i = 0; my @keywords = qw(CREATIONDATE RELEASE); # Add catalog info to hash my $url = mangle_url($catalog); $catinfo{$url}{url} = $catalog; $catinfo{$url}{filename} = $filename; # Initialize foreach (@keywords) { $catinfo{$url}{$_} = "-"; } my $CATALOG = gensym(); open( $CATALOG, "<$filename" ) or myexit( "Can't open $filename", "$!", 1 ); while ( my $line = <$CATALOG> ) { chomp $line; # Look for magic comments if ( $line =~ /^#\s\w/ ) { foreach (@keywords) { if ( $line =~ /^#\s.+\s.+$/ ) { my ( $key, $value ) = ( $line =~ /^#\s(.+)\s(.+)$/ ); if ( $key eq $_ ) { $catinfo{$url}{$_} = $value; } } } } if ( $line =~ /^\w/ ) { @llst = split( / /, $line ); if ( $llst[0] && $llst[1] && $llst[2] && $llst[3] && $llst[4] && $llst[5] && $llst[6] && $llst[7] ) { $pkg{ $llst[2] }{ $llst[1] } = $line; $commonpkg{ $llst[0] } = $llst[2]; push( @{ $pkgmirror{ $llst[3] } }, $catalog ); $i++; } } } # Compare state file and catalog releases print "DEBUG:Catalog release:$catinfo{ $url }{ RELEASE }\n" if $debug; $catinfo{$url}{RELEASE} = "-" unless defined $catinfo{$url}{RELEASE}; $state{RELEASE} = "-" unless defined $state{RELEASE}; if ( "$catinfo{ $url }{ RELEASE }" ne "$state{ RELEASE }" ) { unless ( $yes || "$catinfo{ $url }{ RELEASE }" eq "-" ) { print "The release level in the previous state file (" . $state{RELEASE} . ")\nand the current catalog (" . $catinfo{$url}{RELEASE} . ") differs.\nBe aware that many " . "packages may have changed.\nDo you want to continue? ([y],n) "; chomp( my $prompt = ); if ( $prompt =~ /^[nN]/ ) { myexit( "", "", 0 ); } } # Write the state file with the new release my $STATE = gensym(); open( $STATE, ">$workdir/pkgutil.state" ) or myexit( "Can't open $workdir/pkgutil.state", "$!", 1 ); print $STATE "RELEASE=$catinfo{ $url }{ RELEASE }"; close $STATE; } close $CATALOG; $catinfo{$url}{num_of_pkgs} = $i; return $i; } # Remove packages (-r) # pkgs - packages to remove sub remove { my @pkgs = @_; my $retval = ""; my $pkgrm = "/usr/sbin/pkgrm"; my $pkgrmopts = ""; my $pkgforce = ""; my $pkgtrace = ""; my ( $i, $depinuse, $skip ); my ( @cswpkgs, @deptmp, @rempkgs, @cswpkgstmp ); $pkgtrace = "-v" if $trace; my $root_path = $config{root_path} ? "-R $config{root_path}" : ""; $pkgrmopts .= " $config{pkgrmopts}" if $config{pkgrmopts}; print "Looking at installed packages ...\n"; if ($noncsw) { @cswpkgstmp = `/bin/pkginfo $root_path`; } else { @cswpkgstmp = `/bin/pkginfo $root_path | grep CSW`; } foreach my $pkg (@cswpkgstmp) { ($pkg) = ( $pkg =~ /\s+?(\S+?)\s/ ); $skip = 0; foreach (@pkgs) { $skip = 1 if ( $_ eq $pkg ); } push( @cswpkgs, $pkg ) unless $skip; } print "Examining dependencies for:\n"; foreach my $userpkg (@pkgs) { ($i) = ( $userpkg =~ /(\S+)-/ ); print " $i"; $depinuse = 0; foreach my $j (@cswpkgs) { $retval = parse_catalog( $j, 6 ); if ( $retval ne "none" && $retval ne "not in catalog" && $i ne $j ) { (@deptmp) = split( /\|/, $retval ); foreach my $k (@deptmp) { if ( $k eq $i ) { print STDERR "DEBUG:\n$i is in use by $j\n" if $debug; $depinuse = 1; last; } } } $depinuse ? last : next; } push( @rempkgs, $userpkg ) unless $depinuse; $depinuse ? print " (in use)\n" : print " (remove)\n"; } if ( scalar(@rempkgs) > 0 && !$yes ) { print scalar(@rempkgs), " package" . ( scalar(@rempkgs) > 1 ? "s" : "" ) . " to remove. Do you want to continue? ([y],n,auto) "; chomp( my $prompt = ); if ( $prompt =~ /^[nN]/ ) { myexit( "", "", 0 ); } elsif ( $prompt =~ /^a(uto)*/i ) { print "Turning on automatic mode as if --yes was passed.\n"; $yes = 1; } } $pkgforce = "-a $admin -n" if $yes; if ( scalar(@rempkgs) > 0 ) { run_hooks( 'prebatchremove', @rempkgs ); foreach (@rempkgs) { my ( $p, $v ) = ( $_ =~ /(\S+)-/ ); $retval = check_pkg( $p, 0 ); if ( $retval ne "notinst" ) { myexit( "Option -n selected, stopping here.", "", 0 ) if $nomod; print "\n=> Removing $p\n"; run_hooks( 'preremove', ($_) ); system( "$pkgrm", split( ' ', $root_path ), split( ' ', $pkgforce ), split( ' ', $pkgtrace ), split( ' ', $pkgrmopts ), "$p" ); run_hooks( 'postremove', ($_) ); } else { print "$p not installed\n"; } } run_hooks( 'postbatchremove', @rempkgs ); } else { print "Nothing to remove.\n"; } myexit( "", "", 0 ); } # Remove list of packages with pkgrm # pkgs - packages to remove sub rem_pkgs { my @pkgs = @_; my $pkgrm = "/usr/sbin/pkgrm"; my $pkgrmopts = ""; my $pkgforce = ""; my $pkgtrace = ""; $pkgrmopts .= " $config{pkgrmopts}" if $config{pkgrmopts}; if ( scalar(@pkgs) > 0 && !$yes ) { print scalar(@pkgs), " package" . ( scalar(@pkgs) > 1 ? "s" : "" ) . " to remove. Do you want to continue? ([y],n,auto) "; chomp( my $prompt = ); if ( $prompt =~ /^[nN]/ ) { myexit( "", "", 0 ); } elsif ( $prompt =~ /^a(uto)*/i ) { print "Turning on automatic mode as if --yes was passed.\n"; $yes = 1; } } $pkgforce = "-a $admin -n" if $yes; $pkgtrace = "-v" if $trace; my $root_path = $config{root_path} ? "-R $config{root_path}" : ""; if ( scalar(@pkgs) > 0 ) { run_hooks( 'prebatchremove', @pkgs ); foreach (@pkgs) { myexit( "Option -n selected, stopping here.", "", 0 ) if $nomod; print "\n=> Removing $_\n"; my $pkgver = check_pkg( $_, 0 ); run_hooks( 'preremove', ("$_-$pkgver") ); system( "$pkgrm", split( ' ', $root_path ), split( ' ', $pkgforce ), split( ' ', $pkgtrace ), split( ' ', $pkgrmopts ), "$_" ); run_hooks( 'postremove', ("$_-$pkgver") ); } run_hooks( 'postbatchremove', @pkgs ); } else { print "Nothing to remove.\n"; } } # Run hooks sub run_hooks { my $hook_name = shift; my @hook_args = @_; my $hook_dir = "/etc/opt/csw/pkg-hooks/$hook_name.d"; my ( $hook, $hookfile, $oldwd, $status, $code ); my @hooks_to_run; my @valid_hooks = ( 'prebatchinstall', 'prebatchupgrade', 'prebatchremove', 'preinstall', 'preupgrade', 'preremove', 'postbatchinstall', 'postbatchupgrade', 'postbatchremove', 'postinstall', 'postupgrade', 'postremove', 'prefetch', 'postfetch', 'preargproc', 'postargproc' ); myexit( "Invalid hook: $hook_name", "", 1 ) unless ( grep { /$hook_name/ } @valid_hooks ); if ( !-d $hook_dir ) { print STDERR "DEBUG:No $hook_name hook scripts\n" if $debug; } else { $oldwd = getcwd(); chdir($hook_dir) or myexit( "Could not cd to $hook_dir", "", 1 ); @hooks_to_run = glob("*"); print STDERR "DEBUG:Executing $hook_name hook scripts\n" if ( scalar(@hooks_to_run) && $debug ); foreach my $hookfile ( sort { $a cmp $b } (@hooks_to_run) ) { $hook = "$hook_dir/$hookfile"; if ( -x $hook ) { print STDERR "DEBUG:Running $hook\n" if $debug; # @hook_args is (in most cases) a list of # CSWfoo-1.2.3,REV=YYYY.mm.dd affected packages, but in other # cases, it might be single or multiple URL's of packages # being pulled down, etc system( "$hook", @hook_args ); $status = $?; $code = $status >> 8; print STDERR "DEBUG:Script $hook_name.d/$hookfile returned code: $code\n" if $debug; # This allows a hook to stop execution of any further # package actions if ( $code == 1 ) { myexit( "Hook $hook_name.d/$hookfile returned with code 1", "dying", 1 ); } elsif ($code == 2 && $config{'stop_on_hook_soft_error'} eq 'true' ) { myexit( "Hook $hook_name.d/$hookfile returned with code 2", "respecting configuration option stop_on_hook_soft_error", 1 ); } elsif ( $code > 2 ) { print STDERR "Hook $hook_name.d/$hookfile returned undefined code $code.\nContinuing anyway ...\n"; } } } chdir($oldwd); } } # Signal handler # signame - signal caught sub signal_handler { my $signame = shift; myexit( "\npkgutil caught a SIG$signame. Exiting.", "", 1 ); } # Build package streams (-s) # arch - architecture # rel - os release # output - file name for package stream sub stream { my ( $arch, $rel, $output ) = @_; my ( $FH, $mode, $transfile ); if ($output) { $FH = ( $output eq "-" ? *STDERR : *STDOUT ); $mode = ( $output eq "-" ? 4 : 3 ); } else { $FH = *STDOUT; $mode = 3; } if ($output) { if ( $output eq "-" ) { $transfile = "/dev/fd/1"; } else { if ( $output =~ /\// ) { if ( $output =~ /^\// ) { $transfile = $output; # Output given is an absolute path } else { myexit( "Relative output paths are not allowed", "", 1 ); } } else { $transfile = "$pkgdir/$output"; } } } else { $output = "$ARGV[0].$arch.$rel.pkg"; $transfile = "$pkgdir/$output"; } print STDERR "DEBUG:output: $output\ntransfile: $transfile\n" if $debug; my @install_order = install( $mode, 0, 0 ); # Download packages needed myexit( "", "", 0 ) if ( scalar(@install_order) == 0 ); # Empty list, nothing to do print STDERR "DEBUG:install order: " . join( ' ', @install_order ) . "\n" if $debug; foreach (@install_order) { # Delete package directories my $status; $status = system( "/bin/rm", "-rf", "$pkgdir/$_" ) if ( -d "$pkgdir/$_" ); myexit( "Could not delete $pkgdir/$_", "$!", 1 ) if $status; } foreach (@install_order) { # pkgtrans them one by one my $file = parse_catalog( $_, 3 ); print $FH "Transforming $_ ...\n"; my $status = system( "$gzip -c -f -d $pkgdir/$file | /bin/pkgtrans /dev/fd/0 $pkgdir all 2> /dev/null" ); myexit( "Could not transform $file", "$!", 1 ) if $status; } # pkgtrans all of them into one package stream print $FH "Transforming packages into stream ($transfile) ...\n"; my $status; $status = system( "/bin/touch", "$transfile" ) unless ( $output eq "-" ); myexit( "Could not create stream file", "$!", 1 ) if $status; my $transpkgs = join( " ", @install_order ); $status = system("/bin/pkgtrans -s $pkgdir $transfile $transpkgs 2> /dev/null"); myexit( "Could not transform packages into stream", "$!", 1 ) if $status; foreach (@install_order) { # Delete package directories my $status = system( "/bin/rm", "-rf", "$pkgdir/$_" ); myexit( "Could not delete $pkgdir/$_", "$!", 1 ) if $status; } # Print cmd needed to install print $FH "\nInstall commands in dependency safe order:\n\n"; foreach (@install_order) { print $FH "pkgadd -d $output $_\n"; } myexit( "", "", 0 ); } # Show usage info sub usage { print <, -1, 0, or 1 if p1 is less than, equal to or greater than p2 # Note that if neither has a REV code, -1 is *ALWAYS* returned. # p1rev, p2rev - versions to compare sub verscmp { my ( $p1rev, $p2rev ) = @_; # crev (new), irev (old), then 1 => upgrade my ( @p1list, @p2list ); my $p1tmp = ""; my $p2tmp = ""; my $update = 0; my $skip = 0; # 1st case: same strings => no upgrade $skip = 1 if ( $p1rev eq $p2rev ); # 2nd case: installed no REV, catalog REV => upgrade if ( !$skip ) { if ( $p1rev !~ /REV=/ && $p2rev =~ /REV=/ ) { $update = -1; $skip = 1; } elsif ( $p2rev !~ /REV=/ && $p1rev =~ /REV=/ ) { # Reverse case (installed REV, catalog no REV => "downgrade") $update = 1; $skip = 1; } } # 3rd case: installed REV, catalog REV => if newer, upgrade if ( !$skip ) { if ( $p1rev =~ /REV=/ && $p2rev =~ /REV=/ ) { if ( $p1rev =~ /rev=/ ) { ($p1tmp) = ( $p1rev =~ /REV=(.+)_/ ); } else { ($p1tmp) = ( $p1rev =~ /REV=(.+)$/ ); } @p1list = split( /\./, $p1tmp ); if ( $p2rev =~ /rev=/ ) { ($p2tmp) = ( $p2rev =~ /REV=(.+)_/ ); } else { ($p2tmp) = ( $p2rev =~ /REV=(.+)$/ ); } @p2list = split( /\./, $p2tmp ); for ( my $i = 0 ; $i < scalar(@p1list) ; $i++ ) { $p1list[$i] =~ s/[^0-9]//g; # Only digits $p2list[$i] =~ s/[^0-9]//g; if ( $i >= scalar(@p2list) ) { # p1list is longer than p2list $update = 1; last; } if ( $p1list[$i] != $p2list[$i] ) { if ( $p1list[$i] > $p2list[$i] ) { $update = 1; } else { $update = -1; } print STDERR "DEBUG:$i $p1list[$i] $p2list[$i] $update\n" if $debug; last; } print STDERR "DEBUG:$i $p1list[$i] $p2list[$i] $update\n" if $debug; } $update = -1 if ( !$update && scalar(@p2list) > scalar(@p1list) ); $skip = 1; } } # 4th case: installed no REV, catalog no REV => upgrade if ( !$skip ) { $update = 1 if ( $p1rev !~ /REV=/ && $p2rev !~ /REV=/ ); } return $update; } # Main init(); parse_cl(); myexit( "", "", 0 ); # POD start =head1 NAME pkgutil - install Solaris packages the easy way =head1 SYNOPSIS pkgutil [option]... [package]... =head1 DESCRIPTION Pkgutil, written in Perl and licensed under GPL, is a tool to make installation of packages in Solaris easier. It handles package dependencies so all required packages are installed before the desired package automatically. A catalog is used to make this possible. The format is: S Example: S In the example CSWbind has two dependencies separated by a pipe. Multiple categories can also be separated by pipe characters. =head1 OPTIONS =over 5 =item B<-i, --install> Install package. Will install the specified packages with all their dependencies. You may specify an explicit version (e.g. amarok-1.4.8,REV=2008.02.26) if desired, otherwise the latest version found is chosen. =item B<-u, --upgrade> Upgrade package. A special argument is "all" which will upgrade all installed packages if possible, no argument is the same as "all". If one or more packages are given as arguments only those will be upgraded. =item B<-r, --remove> Remove package. This will remove a package including all dependencies that are not in use by other packages. Note that this feature is experimental. Use with caution. =item B<-d, --download> Download only. Same as install but stops after downloading the packages. =item B<-U, --catalog> Update catalog. =item B<-a, --available> Show available packages. =item B<--describe> Describe available packages. =item B<-c, --compare> Compare installed packages to current. =item B<-C, --compare-diff> Compare installed packages to current, show only different versions. =item B<-A, --compare-avail> Compare available packages to those installed. =item B<-e, --email=address> Send e-mail with available updates. E-mail address as argument. Don't use with other options. =item B<-t, --temp=site> Temporarily use this site for download. Must be the complete url where to find the catalog and associated packages. May be specified multiple times. =item B<-s, --stream> Build a package stream for a certain architecture and OS release. All dependencies will be included in the stream and the needed command to install them in the correct order will be displayed. Must be used with -d. =item B<-T, --target=arch:rel> Specify architecture and OS release when downloading, e.g. i386:5.9 or sparc:5.10. If not specified defaults to architecture and release of the host running pkgutil. =item B<-o, --output=file> File name for package stream. Used with -s. A special argument is "-" which sends the stream to standard output, see example below. The default name is the first package argument followed by architecture and OS release, for example "bind.i386.5.10.pkg". =item B<-x, --exclude=pattern> Simple pattern that will exclude matching packages. This option can be specified multiple times. =item B<-W, --workdir=path> Path to use for work directory. This can be used to run pkgutil as non-root, e.g. called from a web server. =item B<-P, --pkgdir=path> Path to use for package downloads. This can be used to run pkgutil as non-root, e.g. called from a web server. Default is /package. =item B<-R, --rootpath=path> Path to use for root_path. This is used by Solaris pkg tools like pkgadd, pkgrm and so on. Setting this option overrides root_path in pkgutil.conf. Default is not set. =item B<--config=file> Use this configuration file instead of the default ones. =item B<-y, --yes> Answer yes on all prompts. Skips prompt when multiple packares are to be downloaded. Makes pkgrm/pkgadd operations more silent and without prompts. Only makes sense with -i and -u. =item B<-f, --force> Force updates regardless of version compare result, as long as local and mirror version is not the same an update is carried out. This can be used as a rollback from the testing mirror to current or from current to stable for example. =item B<-n, --nomod> No modifications are made to the system. Stops before downloading catalog/packages. Use it to simulate if catalog needs updating or which packages will be downloaded. Only makes sense with -i, -u and -U. =item B<-N, --nodeps> No dependencies, only what you specify on the command line will be used. Useful when using pkgutil as a download tool of specific packages or if you use the testing repo that might pull in unwanted packages. =item B<-D, --debug> Debug mode. Adds a lot of info about what's going on. Only use if you're having problems you think is a bug. =item B<--trace> Set trace mode (-v) for pkgadd/pkgrm. =item B<-h, --help> Show this help. =item B<-v, --version> Show pkgutil version. =item B<-V, --syscheck> System check. This shows info about binaries and more that pkgutil needs to support all features. =item B<-l, --list> List installed packages. =item B<-L, --listfile> List files in packages. Works on both installed packages as well as on (uncompressed) package files. You can even mix them on the command line. =item B<-F, --findfile> Find files in installed packages. =item B<--deptree=depth> Display dependency tree. Depth is the number of levels to show, minumum is 1. =item B<--extract> Will fetch and extract package content. Must be used with -d. =item B<--single> Single package check. This is much faster than checking all installed packages, note that using something like "-c foo" still checks all packages, it just filters the output to only show lines containing foo. Must be used with -c. =item B<-p, --param=opt:val> Override configuration option. All configuration options in pkgutil.conf can be overridden except the mirror option (use -t for that). This can be useful if you temporarily want to disable gpg checks for example. =item B<--parse> Machine parsable output, no headers and all columns are separated by one tab. Use this together with scripts to get a reliable output format that is simpler to parse. =item B<--cleanup> Clean up obsolete packages. For example a renamed package that is not needed any more. =item B<--catinfo> Display information about the catalogs used, e.g. number of packages and local path. =back =head1 EXAMPLES =head2 Example 1 C<# pkgutil -i CSWbind> Will install CSWbind with all required dependencies. =head2 Example 2 C<# pkgutil -e nobody@foo.bar> Will run silently and send an e-mail (with mailx) to the given address if there's updated packages available. Run it from crontab once weekly. =head2 Example 3 C<# pkgutil -y -o - -s bind | gzip E bind.pkg.gz> Will send a package stream including all dependencies needed for CSWbind to standard output which is piped to gzip. With "-o -" the normal output is sent to standard error and "-y" is used to skip the confirmation prompt. =head2 Example 4 C<# pkgutil -T i386:5.10 -s bind> Will make a package stream including all dependencies needed for CSWbind. The package stream will contain packages for the i386 architecture and Solaris 10 regardless of host used to run pkgutil. =head1 CONFIGURATION Pkgutil uses a configuration file, pkgutil.conf, that contains a few important settings. No modifications are mandatory though since pkgutil will happily run with the defaults. There's a configuration file in /opt/csw/etc/pkgutil.conf. The only thing you normally need to change there is the mirror location. If you have a pkgutil.conf file in /etc/opt/csw it will override the one in /opt/csw/etc on a setting-by-setting basis. If no pkgutil.conf is found in either of those two locations defaults are used. The settings that can be used are: C Tells your proxy server to disable caching during fetching of the catalog and descriptions. Default is true. C Number of days between automatic catalog updates. Special cases are -1 if you want to disable automatic updates and 0 if you always want to update the catalog. Default is 14. C Filter out CSWcommon from --deptree output. Useful since almost every package depends on CSWcommon, setting this option to true reduces the number of lines a lot without affecting the actual information much. Default is false. C Space separated list of simple patterns that will exclude matching packages when updating or installing. If you, e.g., never want cups related packages updated accidentally you can add the string cups here, this will exclude all package names that contain that string. Default is blank. C The path to the gpg directory (instead of ~/.gnupg or /var/opt/csw/pkgi if CSWpki is installed) when verifying the catalogs integrity. C During dependency calculation the recursive algorithm needs to be protected against cyclic dependencies in the catalog (packages that list each other as dependencies) or pkgutil will not stop until memory is exhausted. This sets the maximum number of recursions before pkgutil stops. C This is the mirror that is used for downloading the catalog and packages. Try setting it to your nearest mirror to improve download speed. This option may be specified multiple times. It also supports (in an experimental way) the file:// protocol for local/NFS mirrors. Example: C C Enable (default is disable) support for non-CSW prefixed packages. Pkgutil also uses a file to configure pkgadd when the yes (-y) option is used. This file is located in /var/opt/csw/pkgutil and is called admin. It's by default set up to fully automate installations but if you change something in this file it will be preserved during upgrades of pkgutil. Read more about the admin file with "man -s4 admin". C Send options to pkgadd, one example is -G that will only install the packages in the global zone for Solaris 10. A useful setting is -S, that will not display the license during install. C Style of package list when installing/upgrading packages. 0 is the one used since the first version of pkgutil, it's space efficient but less readable. 1 is the one introduced in v1.7, it's one package per line which is easier to read. 2 is the same as 1 but also displays which distribution a package comes from, e.g. unstable or stable. C Send options to pkgrm, one example is "-O nozones" that will only deinstall the packages in the global zone for Solaris 10. C Set alternate root path (-R with pkg commands). Default is /. C Show the current list of packages or not. You can choose to not show the list of current packages to get less output when doing operations. Default is true. C This option determines whether or not execution will be halted if a hook returns 2 as its exit code. Execution is always stopped if a hook returns 1. Set this to true to enable it. C C These two can enable (default is disabled for both) checking the catalogs integrity (GPG) and that each downloaded file is unchanged from the published one (MD5). To use GPG you need CSWgnupg installed. MD5 is supported by default in Solaris 10 and on Solaris 8 and 9 if you have CSWperl installed and have /opt/csw/bin first in your path. You can also install CSWcoreutils to get MD5 support. C Send options to wget, for example to show more or less information during downloads. =head1 PKGASK RESPONSE FILES Pkgutil supports pkgask response files and will use them if you provide them. Create a pkgask directory in your work directory (normally /var/opt/csw/pkgutil) and put your response files there. =head1 SEE ALSO http://pkgutil.net http://sourceforge.net/projects/pkgutil =head1 TODO Add unit testing. =head1 AUTHOR Peter Bonivart =head1 CREDITS Mark Bannister Joe Baro Maciej Blizinski Dennis Clarke Ihsan Dogan David Everly Neil Houston Don Jackson Sebastian Kayser Trygve Laugstol James Lee Juraj Lutter Dagobert Michelsen Yann Rouillard Remko de Vrijer Ben Walton Derek Whayman For more details, see the readme file. =head1 COPYRIGHT AND DISCLAIMER Copyright (C) 2008-2012 Peter Bonivart. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA. =cut 0707010020a356000041ed000027130000271000000003502b7c6500000000000000c300000fc500000000000000000000001500000000root/opt/csw/libexec0707010020a357000041ed000027130000271000000002502b7c6500000000000000c300000fc500000000000000000000001d00000000root/opt/csw/libexec/pkgutil0707010020a359000081a4000027130000271000000001502b7c5e00036da0000000c300000fc500000000000000000000002800000000root/opt/csw/libexec/pkgutil/wget-sparcELF;H4ih4 (44  Ô©B©B©D©D>>tL®È®Èà/usr/lib/ld.so.1ol !#$%')*+,-./13567:;=>?@CDFGIKLMNOPQRTUWY[\^_`acdfgiknpsuvwx{}~€‚„…†‡ˆ‰‹ŒŽ‘“”•—™šœž£¤¦§¨«¬°±²´µ¶·¸¹º¼½¿ÀÁÂÃÅÉÊÌÍÎÏÐÑÒÓÔÖ×ÙÛÝàâãåçéêëíîðòóôõ÷ùûýÿ    "#%&')+,-/012679;<=?CDEHIJLMNOPRSUVWYZ\]_`abdefik  "&(02489<ABEHJSVXZ]behjlmoqrtyz|ƒŠ’–˜›Ÿ ¡¢¥©ª­®¯³»¾ÄÆÇÈËÕØÚÜÞßáäæèìïñöøúüþ  !$(*.3458:>@ABFGKQTX[^cghj­  ªŒ®p²0  .²Xp 8ü¼d DÅh R¬TY­`éä l@t  zõÜL „­\Œ²L0 •ã@ ŸÖа  x Ð"àH åì  ù¡Ø  ¬À H #ð 4¼Xh E3\ Ì VÕl@ b¼P p1à  x«~D´ Œx, ™–À  ¦­Œ«ݸL Ã?¸ô Ì®¬ÑÄh ߃ˆÀ ä©Øééô ðÊd ú¬/DL DH€ ­ì®L -8L )°Ü 2ª9T Gª,Sª˜_ý0 nî  }úXd ‹®X’ 4„ Ÿ¬ü©g ° ðÀ »>¸ ËBTˆ Ö«Ý°å®Èî¬ õBÜŒ ÿ;H   #«X+ª 6¬H=®EãÐp Y{¨ n?Hp Å€ø ‘Ûp, žª¥­¬A¬¨ ¶©¼©BÃ`´l ÌïhŒ ÛïD$ ì0$  ä@h ¬ð"®((­t1·ˆÈ :ø° O­ÈVñœ@ `¯ˆÄ jÒhÜ y÷ð4 ‡)¸Œ Ž«Ð–V P «xô ³'Ę º(\” Å©x̶ÈÀ ÕªDÜëÀX ðªPõ èP( -@5ÐÐ<¬´C´T Q±¼< j¬{î $ 0£ñTD ®ð L ºDXÌ ÁµL´ ÊÔ¬” Ü­D⪤é&x ò2èt ûX, P€­¤®”%õ$ 3õ4” <©œE°Q«ÜY¬`_«Le@€( r«(yC´¤ ­ø†ÓäÔ › H  –ì ¯Çx€ Áª¼Ìùœ¬ Õ®ÜDÌé²< ý©D­hA ô /ÂTX A–¨ V.ì( d­8o!ÄP uc¨œ €©Hš¬„¨Hìµ<¿@¨` Χ܀ ×<èÐ æCx€ ôªàüë˜(  ªÔìÄ '#°, 3Çà‘è’ Ü@@ê Ô@Í à’@@ä @ÍÄ €  €Ô¡ @AÈ’@O'Çà‘è’¡@@Ó Ô@Í¡ ’@@Í @ÍÄ €  €Ô¡<@A±’@OÇà‘è ’¡L@@¼ Ô@Ìì¡P’@@¶ @ÌðÄ €  €Ô¡d@Aš’@NùÇà‘è ģ؀  € FÔ@ÌÔ¡t’@@ž Fģ؀  €Ô’¡€@AG „ Ä'¿Ü’À@˜€¢ €+Ð'¿à€¢ €Ô€¢ €Ô€!’¡@@ Ô@̱¡”’@@{ @̵Ä €  €Ô¡Ì@A_’@N¾à¿àÇà‘è’¡Ü@@i Ô@Ì™¡à’@@c Fģ؀  € FÄ¿à€  € FÔ@ÌŠ¢ ’@@T Fģ؀  €Ô’¢@@ý º  ’À@¦€¢ €+Ð'¿à€¢ €Ô€¢ "€ÄÀ€Ü’¢(@@8 Ô@Ìh¢,’@@2 @ÌlÄ €  €Ô¢d@A’@Nuà¿àÇà‘耠 €Ô@Ì{ÐÀÔ@i<¢tÐ$ÀÄ¿ÜÄÀ€  €MFÐÀ¶ @̉’ [Ð'¿Ü„"€Ä¿Ü @Ì‚’ ]Ŀܶ€  €5€¦à"€4Ä ÄÀÆ Ä'¿à€ à"€Ä Ô@@袨Ä €  €„ /ÒÀÔ@@à¢Ô„ /Æ¿àÄ(àп܈ €¡€†àÄI €  .€„ /€Ä(àÄI Ä(àˆ †à€¡*¿ÿöÄI À(àÄ €  €FÒÀÔ@@¢ä€ FÄ €  €FÔ@@¹¢xFģ؀  €Ô@Ëö¢ô’@?À @—Ð`…* …8 Ä'¿ÜFģ؀  €Ô ’¢ü@@cÔ¿Ü@Äҿܶ€¢ € €¢ €TF€¢ €9Ô€G€Ô€¢ 7€Ô€@’£@?˜ Ô@ËÈ£’@?’ @ËÌÄ €  €Ô£L@@v’@MÕÇà‘è’£\@? Ô@˱£`’@?{ @˵Ä €  €Ô£Œ@@_’@M¾Çà‘è’£œ@?j Ô@Ëš£ ’ @@Ô¿Ü@ËÄ €  €Ô£Ð@@G’@M¦Çà‘èģ؀  € €Ž`Ô@Ë£à’@?K €Ž`€ûÕÄ` ÄH €  € Ô@Ët£è’@?> €õFì` FÄãà€  "€ÄM Õ@@! ÄM €  /€3„  Ä'¿à@Ë‹ÐÀ @ˈÐ` „ €¤ „€  ?øœ#€ h€Ð'¿Ü7† è€Ä¿à7† ìÄ¿àÔÀÕ–’ @Ë«˜FÄ£à€  €FÕ@?ø $FÄ£à€  "€ì¿ÜÕ P’@?îÔ¿Üì¿Ü„ ÄÀ€  €6F@ËW ?øœ#€ h @Ët’ÄL €  /€•„ [Ä, ˆ ÆL € à€ „ ]ÄI † .€  /"€Æ) ÄI ˆ €  2¿ÿúÄI „ ]Ä) ø) FÄ£à€  €FÕ@?¿ „FÄ£à€  "€¬Õ’ ¨¬@?´”F„càÄ¿ø€  €Õ ’ Ä@?m”@ û’ €¢ € €¢ €WF€¢ €;Õ€]€Õ€¢ 7€Õ€V’ Ô@>¢ Õ@ÊÒ Ø’@>œ @ÊÖFÄ£à€  €Õ¡@?’@LÞÇà‘è’¡ @>Š Õ@ʺ¡$’@>„ @ʾFÄ£à€  €Õ¡P@?g’@LÆÇà‘è’¡`@>r Õ@Ê¢¡dÔ` ’@? @Ê¥FÄ£à€  €Õ¡€@?N’@L­Çà‘è„càÄ¿ø€  €FÕ@ʇ¡’@>Q €F@Ê€¡˜’@>J F¬¢Ð„Ž`€GÄ'¿à€¥ €E„Ž` Äà€  €A„Ž` FĢЀ  "€ Ò`$Ä¡€  2€Ò`$ÕÔ`$’¡°@>â Ò`$@Ç”€¢ €!Ð'¿Ü€¢ €Õ€¢ €ØÕ’¡Ä@> Õ@ÊO¡È’@> @ÊSÄ¡€  €Õ¢@>ý’@L\à¿ÜÇà‘èÄ¡€  € „Ž` Õ@Ê6¢’@> „Ž` €]Ä'¿ÜÄ œ€  €¥€§ Ä¡€  €’¿ìÕ’¢@=ñ ’¿ì@  €¢ '€ €¢ €T€¤ €¢ €Õ€¢ &€DÕ€˜€5Õ€¢ 7€Õ€‘’¢(@=Õ Õ@Ê¢,’@=Ï @Ê Ä¡€  €Õ¢d@>³’@LÇà‘è’¢t@=¾ Õ@Éî¢x’@=¸ @ÉòÄ¡€  €Õ¢¤@>œ’@KûÇà‘è’¢´@=§ Õ@É×¢¸’@=¡ € €¤ ’¢Ø@=œ Õ@É̢ܒ@=– €¤ €?€§ Ä¿ðÆ¿ñ¿ì…( „€…( …0 Ä'¿ä’ÿî…” „€%Ð'¿ôG案@ɽÄ¡€  €Õ¢ü@>g’@KÆÕ@ɧ£  @`¿ì¢@É°˜’” @>Ö¿ä€¤à’€Ô    Çà‘èÄ¡¸ €  € €§ Õ@É£,’@=W €§ €µ€¥ Ä¡€  €Õ’£8@=L @  €¢ ¶€€¢ €¢ € €¢ €QÕ€¢ €iÕ€ø€eÕ€¢ €bÕ€ñ€ €¢ "€†Ä¡€¢ €jÖ€ç€Õ€¢ 7€Õ€à’£H@=  Õ@ÉP£L’@= @ÉTÄ¡€  €Õ£„@=þ’ÿïˆÐ¿ô@K[Çà‘è’£”@= Õ@É7£˜’@= @É;Ä¡€  €Õ£Ä@=å’ÿïoпô@KBÇà‘è’£Ô@<î G@É-СˆÕ”’£Ø@=˜ @É Ä¡€  €Õ£ä@=Ê’ÿïTпô@K'Çà‘è’£ô@<Ó Õ@É£ø G@ÉСˆ’”@=z ÿï@пôÇà‘è’  @<Á Ö@Èñ ’@<» @ÈõÄ¡€  €Ö  @=Ÿ’ÿï)пô@JüÇà‘耠 € €¥ Ö@ÈØ 0’@<¢ €¥ €†Ä¿à€  "€„Ä¿àÄ¡€  €Ö ’ <@=E”@ ’ €¢ € €¢ €d€¤ €¢ € Ö€E"€9Ä ˆ€¢ 7€Ö€>’ P@Çà‘è ÄHà€  2€@ÆD€¦?ÿ€ ×× ’ ”@:–×@Æ  ’@9Ø Çà‘è @Æ1€¦?ÿ€€Ž`Çà‘è 2€Ä¡@ÆÄ¡€  €× $@:±’@HÄ¡€  €,  *Äà€ˆ €(  *@[ ÐÀ×ÐÀ@Æ=’ 4 € G@ÅðСˆ×ÔÀ–’ 8@:Z €  *×@eû¤ @¢€ ’ @:O”@Åø@eñ¢¿ÿø’@Æ$  *Çà‘èÓ£ŒÓ’£˜@ŵ” ‰¿÷ÝÓ£ Ó’£´@Å­” Š¿÷Ú„Ž`£¼Ó’£ä@Ŧ” ¿÷Ú€Ž`£ìÔ’ $@ÅŸ” ‘¿÷ÖÄ`(Ô ,Ô’ <@Å—” ˜¿÷ë„?ÿ@ÅØ@Å‹ ¿øÊF@ÅÒ¿ùF@ÅοùFÄ¿Ü@ÅÊ¿úFÕ lÕ’ |@Å}”!™¿úg„ [@ž¿úóF@ź¿ûBÄ¡@Ŷ¿û²€¤ @Ų¿ü˜Ä¡@Å®¿ý€¤ @Ū¿ýŽÄ¡@Ŧ¿ýúÄ¡$,,è$èè,,è,,èèè$,,$è,,è,@èè$$èèèèèèèè,$$èèèèèèèèèèèèèè,ã¿¢¦ $ Æ€®€ à€F@[îÐ&€F¤£ Ä£ €  €e@c\Ѐ€€ e×@Å DÔ€’@9‘ Çà‘è "´ (@c"Ð@Ä @€  2€ì @ì@€¦ ¦ Ä`€ˆ €¸ „ Ä$`Ä`€ˆ €7 ¸ ;<ª`¦à@S¯Ä`€ˆ €À$`Ä`„ Ä$`@G€"€Ä`Ä`„¿üÄ$`€€¤à„ Ä$`€€¤à@Fô€"€Ä`Ä`„¿þÄ$`€Ä`„ Ä$`Ä`€ˆ "€Ä`Ä`„¿ýÄ$`€€¤à„ Ä$`€¤à€¨ Ä L€  "€Ä LÄ`€ˆ 2€Ä L@bû€"€Ä L’¿x@Å-€2€Ä LÄ¿Œ„€€ €"€è¿¨Ä L€  €€¥ €Ä`„  Ä$`@b  Ä¿Ä€  € €¤ °@]e’ ²¿h×@Äå’ p€¤à€ ××@ÄŽ |’¿h@Äð”ט¿h’ ˆ ”–@9š@Ī€¤ "€À'¿dÄ Ä'¿d€’¿d’¿d”ÿö‹–°@Fˆ€2€Ä`Ä`„¿ýÄ$`€†„ Ä$`†„& €  6€¶…( Ä€À€Çà‘èÒ¿Ì@R΀Ŀ̀¤ "€Ò¿ÌÄ Æ¿d€ À€% Ò¿Ì@RÁÄ¿Ì€  "¿ÿT¦àÄ¿Ì€¤À¿ÿP¦à@FZ€"€’„ ,Ä`€ˆ "€Ž„ ,@ÄCÐ`Ä Ô€  €סP@8íÒ`@FLÇà‘è , @aªÄ¿d° €„ Ò@@P”   @`‹’Ä`€ˆ €×@Ä"Ð`Ä Ô€  €× ¤@8ÌÒ`@F+×@Ä  ´’Ú¿d ”–@8„˜Ä¿Ä€  2€Ä`Ä¿È€  2€Ä`@\Æ’ Ø¿d ×’ Ôæ# \ ”–@8oš@ÄÄ`€ˆ € Ä ð€  €.€§ @RhпdÄ È„ Ä$ È€'€§ @RaпdÄ È„ Ä$ ÈÄ¡€  €€§ Ä Ô€  €××@8Š ô×@ÃÌ¡4’ @8G”@ÄA€€ €§ G@ÃÏСˆ×”’¡D@8: €§ "€Ä`Ä`„ Ä$`€„ "„¿ïÄ$`„ "Çà‘è@Ãè¿ÿ ã¿ -ª $è@Ä`„¿þÄ&`Ä`„ Ä&`Ä`„¿ûÄ&`@Zd ×@b^’¡`®@þFÄ£à€  "€î&@×@ÃŒ¡l@8E’î&@’ ÿþV” €¢ "€ è&@„ Ò@@ ÉÐ& €FÀ& FÄ£ü€  €@Ã퀀 G@Ã|Сˆ×”’¡@7ç € ×@Ãc¡œ’ @7Þ”@ÇÄ`„¿÷Ä&`Çà‘èã¾€, Äà0¢„ Ä à0F¦¢øÄ¢ø€ ¿ÿ€¬FÄ¢øÆà0€ À€€¦`Äà耠 € ,×@Ã>¡¬,Ò 0F@7ôÔ¢ø,Äà0„  Ä à0Çà‘è #€¦`€Ÿ×ò'¾äÄ „¿þÄ& Æ €ˆà2€Ä Ä „ Ä& €Ä „¿ýÄ& Ä „ Ä& @E3 €2€Ä Ä „ Ä& €€¦`„¿þÄ& €¦`€R¨ "9(¤ $¶ ;<@Q¨€€C,î@¨ "ª @_îР$Ò °@Vç@YÃÐ$@Äà쀠 "€DÄ Ä €  2€@Ä Ð@@Ãf’¿x€2€:Ä Ä@ò¿¨È¿¸€  € „ Ä@€  €„ €† „ † €  "€Ä † Ä „@€ Ä †`ÿÿ€ €€€ à€ € à×@ÂÌ¡ìÔ@’ª @7F €Ä € ×@ÂÁ¢,Ô@’@7< € Ä ×@¸¢h’ @73”Ä €  € €  €{€¥`€  "€lÄÿð€†Ä "€ÄàP€  "€z×€Ä €  €W€¥`Ä €  € ×@˜¢œ’@6b €qÄ Ð@@Ã’¾ð€€)×@¸Ð Ä¿„€€ €€"×´ ²  ?øœ#€ `Ð'¾è’Ð@@Âü”€¢€×Ò ”@ÂÎо耀 ×ת @Âm¢ÄÔ@’Ö @6ç €DÄ @Âd¢ìÔ@’Ö @6Þ @ÂØÐ@Ð @ÂÞÒ@€¢?ÿ€ ×G@ÂcСˆ×”’£@6Î ×’£@6 €'Ä "€%Ä ’ÿý”¨€Ä €  2€Ä ×@Â:£Ô ’@6µ €Ä "€Ä ’ÿüÿ”¨€ Ä @Â)£8Ô ’@6¤ Ä €  2€Ä ÄàP€  "€"Ä Ä € ¿ÿ"€Ä €¥`"€Ä @`TÐ@€"€Ä ÄàT€  € † ÄàX€  €€ àÆàT€€ àÆ@€ à"€Ä Ò @`€ Ä € ¿ÿ2€ Ä ×@Á÷£\Ô@’@6r Ä €  "€ÄàèÄ €  2€ Äà耥`"€ÄàèÐ@@ÂWÒ € €  €×£x@6—Ò@@ÂÐ@î$@@UÁ’@Áþ€¥ 6€€¥ €€¥ €Ä`„¿üÄ$`à €¤ ¿þ¾€ÄÿðÄà0„  Ä à0Çà‘è 6Äÿð€  €FÄ¢ø€ ¿ÿ€ F,Ä¢øÆà0€ À6€ ÄÿðÒ¾ä@"”¨€,Äÿð€  €,Äà耠 € ,×@Áž£œ,Ò 0F@6TÔ¢ø,Äà0„  Ä à0Çà‘è¡Ø×’¡ä@Á…”$ô¿þ_ò'¾ä㿘¢3Fªcà"€mÄਠخ ׬£à@P€€bÄ`€  2€[â`@Á£Ð  @Á Ð`†„à€  $€à à à ?øœ#€ `¨ÄL €  €×ÄL €  /€×ÄL €  € ××Ö`’£Ø@Á¼”€ÄcàÖ`’£Ð@Áµ”Äcà€  "€Äcà@6Äcà€  €Ô`’@5û–@`¾’ €€ Ø@Á8 L’ @5³”€â`Ä „¿ýÄ& @^Ð  @U’’@” @U’@ÁJâ`€¤`¿ÿÄà€  € „èР€  Ò Äà€â@•8 €â €Çà‘è 6Çà‘è "㿘Ä`¢”¿ü „ Ä$`ÿýY’€¢ ""€Æ¿üÇà‘èFÆ'¿øÄ£$€  €FÄ£(€  "€Ä $€ à€¦Äà€  "€æà@_ÏÐà€€Ø@Àä „’Ôà@5_ ’¿ø@D¦€€¤àæà€¤à2¿ÿêÄàÄ $ÄH €  €1€¦ €€¦ 2€.Ä¿øæ¿ø€¤à€"¨ Ð $Òàÿðâ” €¢?ÿ€¨€¢ €’¿ø@$¦€€¤àæà€¤à2¿ÿðÐ $€€¥?ÿG@ÀÀСˆ„ $–Ô@Ø’ ˜@5( €¥?ÿ2€Ä¿ø@%пøÇà‘è 0Ä¿ø€  €’ÿýE”€€¦ 2€ Ä`Ø@À“  Ô $’@5 € „ Ä$`’ ÿûX”Çà‘è@пø@O!„ "€2€„ 6Çà‘è‚~è〢‚ØÀ$`” (‚@¤  @À~’ )F‚à¦"è‚@@B„ ‚Ø‚@Ä `‚¿ôä `ä `Ä $ÄH €  €d¤ "Ä"耠 €`‚Ø‚@’‚Ô‚@”ÿü£€¢ "¤€~€¤ Äဠ €IÄàd€  €‚¿ü@]+Ðàd¨€Ä`€  €@]"¨€@Vø¨‚Ô‚@Ô`@ °’€¢ €'¤Äÿ耠 €#Äàd€  €‚L ?ÿ‚@’@ÀŽ€€Ø‚|‚@à`@À  À’ ”@4‡–€ Ø@À è’ @4~”@À'‚Ô‚@@yÐ`€-€¤ ÿñjÐ $Äà€€  €€¢ 2€Äà€Ä"耠 2€Äà€Äàü€  € ‚Ø‚@”ÿú±’ ¤€€¤ Äà€€  €€¢ €„ „ €„ ‚Ø‚@’ÿþÔ€¤ "€¤ "€¤ "€Ä`„ Ä$`‚à‚@@AÖ€€‚¿ø‚à‚@@¿ÀÐ`Äàø€  € ‚¿øØ‚à¡‚@@4gÒ`‚¿øÄ`€  €‚¿ø@¿Ï‚¿øÀ `Ä`€  €@¿ÇÇà‘èã¿ æ  ¢ä @¿¾Ð Ä €  €@¿¸Ð @¿¶€¤ €€¤àæ$ "€ä$`ä$àÇà‘èÇà‘èã¿  €â @¿¤Ð Ä €  €@¿žÐ @¿œ €¤`2¿ÿôâ Çàèã¿ @\/ (ѶÐ&`°¡ì9F¢¤ (¦ ¨ ª  ®à¬ '´#ز   €¤$€ ÄÀÐ`¥, @\#’Ð$`¬$ ÄÀ€  "€î&ÀÄÀ„  Ä&À„ÀÆ ˆàÈ  ÄHàÆ`Ä(À„ €€  @AX„€Ð&ÀÄÀ€€  ÄÀ„  Ä&À„ÀÆ ˆàÈ  ÄHàÆ`Ä(À„ €  €SÄ`ÄH€€   €  ¿ÿË€¤Ä`€¤ ò(€$€ Ä#ØÄ`„€ÄH¿ÿ€   2€Ä#ØÄ`„€ò(¿ÿÄ#Ø€  €ØÔ`’¡@3† € €¤ Ä €  €€¤ Ø¡@3¸Ò`€¤ ¿ÿ§  Ä`ÄH „ ÿ…( Ä€€ˆ ¿ÿŸ  Ä`ÄH „ ÿ…( Ä€€ˆ ¿ÿ—  Ä`ÄH „ ÿ…( Ä€€ˆ ¿ÿ  Ä`ÄH €   ¿ÿŠ  FÒ` ¢P@¿^” €ò, Çà‘è Çà‘è ã¿  €¤ @¾ù¤ @¾ö„@[ €¦`€¤7€† ü7†¡€7€Ø ¡Ø’¡ –”@¿˜Fģ؀  €Ø’¡,@¾ò” €€Ø’¡4 @3"”Çà‘èØ’¡<@2j Çà‘èFÄ£à€  €Ø¡T@3M’Çà‘è㿘’¿üªÿÿ%€¢ €¤@¾°Ð¿üÇà‘èÆ¿üÄHà€  2€@¾§Çà‘è @¾£Ø¡`ÿÿ¥’@¾ ¢”Ð ÿå’€€@¾”Çà‘è 7@¾’¿üÿþý€¢ €¤@¾ˆÐ¿üÇà‘èÆ¿üÄHà€  22€ÄHà@¾Çà‘è €  3€¤ @¾xÇà‘è -,¦ ¨ 4Ð ¢@¾r”Ð`@¾wÒ¿ü€€¢`¤ ¦€¤ *¿ÿôÐ`€¤à€-¢ …, @¾`ЀÆ¿üÄJˆÀ€  0&€ÄI ÄJ€  9€…,`ÆI „€ˆ …( „€¢  0ÄI €  0€ÄI €  9¿ÿô…,`ÄI €   € ’ @ ”ª€€@¾7пüÇà‘è @¾3пüØ¡„ÿÿ5’@¾0¢”Ð ÿ䥒€€@¾$Çà‘è 7@¾ ’¿üÿþ€¢ €¤@¾Ð¿üÇà‘èÆ¿üÄHà€  2€@¾Çà‘è @¾ Çà‘è 㿈À7¿þÿãY¿þ€¢ €Çà‘èÿä>Ð ¤€ Çà‘è Ä¿þ?œ#€†ã h†€„ ÿÄ# `‡0àÆ# \ØÔ   ’¡ŒÖ  Ø  @¾#Ú  Ø¡ ÿþé’@½ä ”Ð ÿäY’€€@½ØÇà‘è 7@½Ô’¿øÿþA€¢ € @½ÌпøÇà‘èÆ¿øÄHà€  2€@½ÃÇà‘è @½¿Çà‘è 㿘Ø¡¨ÿþ¾’ @½¹¤”Ð ÿä.’€€@½­Çà‘è 7@½©’¿üÿþ€¢ €¤@½¡Ð¿üÇà‘èÆ¿üÄHà€  2€ˆà@½˜Çà‘è 'ÄHà€  "€ÄI ÄHàцaì„ ÿ…( Ä€€ˆ 2€ÄI ˆ ÄI €  € ÄI „ ÿ…( Ä€€ˆ "¿ÿ÷ˆ ÄI €  € Çà‘è &À.@Ñ’¡ìÄI „ ÿ…( Ä€ €ˆ €Ä@‡( „ÀÆI ˆ …( † à0„ÀÄ.@ÄI „ ÿ…( Ä€ €ˆ 2¿ÿóÄ@ÄI €  ,€€¢ ˆ € €  €¢ &¿ÿßÀ.@@½OпüÇà‘è @½KпüÇà‘è &㿘ò/¿þØ¡°À/¿ÿÿþH’¿þ@½C¢”Ð ÿ㸒€€@½7Çà‘è 7@½3’¿øÿý €¢ € @½+пøÇà‘èÆ¿øÄHà€  2€@½"Çà‘è @½Çà‘è 㿘’Øÿþ¡¸@½¢”Ð ÿã’€€@½ Çà‘è 7@½’¿üÿýu€¢ € @½Ð¿üÇà‘èÆ¿üÄHà€  52€ÄHà@¼÷Çà‘è €  2€@¼ðÇà‘è @¼ìÇà‘è 㿘9’ £¬@_!Ø¡¼ÿýæ’@¼á ”Ð ÿãV’€€@¼ÕÇà‘è 7@¼Ñ’¿üÿý>€¢ € @¼ÉпüÇà‘èÆ¿üÄHà€  3€@¼ÀÇà‘è @¼¼Çà‘è 㿘’Øÿý»¡Ä@¼¶¢”Ð ÿã+’€€@¼ªÇà‘è 7@¼¦’¿üÿý€¢ € @¼žÐ¿üÇà‘èÆ¿üÄHà€  52€ÄHà@¼•Çà‘è €  1€@¼ŽÇà‘è @¼ŠÇà‘è 㿘’Øÿý‰¡Ì@¼„¢”Ð ÿâù’€€@¼xÇà‘è 7@¼t’¿üÿüဢ € @¼lпüÇà‘èÆ¿üÄHà€  52€ÄHà@¼cÇà‘è €  1€@¼\Çà‘è @¼XÇà‘è 㿘Ø¡ÔÿýW’ @¼R¤”Ð ÿâÇ’€€@¼FÇà‘è 7@¼B’¿üÿü¯€¢ €¢@¼:пüÇà‘èÆ¿üÄHà€  5€@¼1Çà‘è Ø@¼Œ’¡ÜØ’¡à@¼ˆ ¢Ø@¼9’¡ä€€„ €Ä&`Ø’¡è@¼0€€Ø€À&`’¡ð@¼(€€„ € Ä&`Ø’¡ü@¼€€„ €Ä&`„ Ä&`@¼Ð¿üÇà‘è 㿘Ø¢ÿý’ @»û¤”Ð ÿâp’€€@»ïÇà‘è 7@»ë’¿üÿüX€¢ €¢@»ãпüÇà‘èÆ¿üÄHà€  5€@»ÚÇà‘è Ø@¼5’¢Ø’¢ @¼1 Ä`€  €¢@»ËÐ`@XÐ&`@»ÆпüÇà‘è 㿘’ØÿüÅ¢@»À¤”Ð ÿâ5’€€@»´À& Çà‘è 7@»¯’¿üÿü€¢ € @»§Ð¿üÀ& Çà‘èÆ¿üÄHà€  5€¤ @»À& Çà‘è !Gàä$!ˆ’ @»÷” Ð& Ä!ˆ€  €@»Ð¿üä& Çà‘è @»ˆÐ¿üÇà‘è ã¿  €Ø’¢@»Š” €€ÄN €  € ÄN Ò†`ì„ ÿÄ€…( …8 Çà‘èÇà‘è Iã¿ @»h€¢  ¢ € Çà‘è “,`ÄL €  x€ ˆ ÄL €  s€ˆ €ÄL ˆ ÄL  ÆL   „ r€ †àw„`?ÿ€ …( †`?ÿ‡(à€¢ „€„€¢@¿ÿå“,`Çà‘èã¿ @»: €†Çà‘è „ˆ  ÄH¿ÿ€   2€ÄI †" À.„ˆ  ÄH¿ÿ€   2€ÄN † àÀ.ÄN €  € ÄL ˆ €   "€È, ÄL   €  2¿ÿúÄL Çà‘èã¿8Øò# `’¢P@»8„€ Ð# \G@ºêСˆØ–’¢T @/T”Çà‘è À# h@ZõÀ# d„€eÑ®¤¡ì,´ <ÿÿ·ØÐ# t’b\@ºõ” €€Ø@ºä€K’¢d@»? 2€À'¿ä@ºÚ€AÀ'¿ôÄJ €  -€ 7F€  d"€„ €  l"€„ € „ ÄãàÀ'¿à€  "€$Ä `Ø@/T¢h€Ä `Ä'¿àÄãà€  "€Ä `Ø@/J¢t€Ä `Ä'¿àÄãà€  "€Ä `Ø@/@¢€€ Ä `Ä'¿àÄãà€  "€Ä `Ø@/6¢ŒÄ `€  €Ä¿à€  €€  "€„!í€ „!¤„!¤Ä'¿ð€ÄãàÄ'¿ð€ÄãàÄ'¿ðÄãà€  "€À# pØ¢˜@/Ò¿ð€À# pÿÿ  ÄãàÐ'¿ð€  "€À# p’Ø@/¢°À# pغ?ÿÀ# l’¢¼¬ @ºÕ ¢ª ² ¨ ° ¸ €aº§`€C¦ Ò  @º:€€  ¦à€¤à &¿ÿùÒ €¤à €ÂØÀ'¿è $`€¤€€¤ÄLþ„ ÿ…( Ä€€ˆ €º ÄL  $ ’  0@º²Ä¿è€¤„€€ Ä'¿è…/`„€»( ÄL „ ÿ…( Ä€€ˆ 2¿ÿïÄL €¤€º Äã฀  €šØ…,àÒ€Ø@.Á¢À€“Ø„ Ä# l€Ä¿ä€§`€€§`ÄL`€  "€ ÄL`ÄL`„  0‡( „ÀÆL`…( „€°  0€Äãà°  0Äãà€  €yØØ¢Ì@.¡’€sØ€m€§`ÄL`¨ ¬ ² ª „ ÿ…( Ä€€ˆ €K€¥ ÄL`„ ÿ…( Ä€€ˆ €…- ÆL`„€¢`…( † à0¨ÀÄL`„ ÿ…( Ä€€ˆ ¿ÿõ…- ÄL`€  :€3€¥ ÄL`²¨ „ ÿ…( Ä€€ˆ €ˆ`…-`ÆI „€ˆ …( † à0ªÀÄI „ ÿ…( Ä€€ˆ ¿ÿõ…-`ÄI €  :€€¥ ÄI „ ÿ…( Ä€€ˆ € …- ÆJ „€ …( † à0¬ÀÄJ „ ÿ…( Ä€€ˆ ¿ÿõ…- €¥ "€ ÄãàÄãà€  €ØØ¢Ø@.?’€Ø€  €ØØ’¢ì”@.4–€Ø€ €’c@¹ú ¢¿ÿ,º§`€ŠÄ¿ä@¹–Æ t„$@„ À€¢€ „ Ä,@Æ¿à€ à€ØØ’£ @¹í„€Ð# t„ Ä# l€rÄ¿ä@V? ÄãàÐ# xÐ'¿ô€  "€Ä tØ£@.Ò xÄ tÀ( Ø’£$@¹>€€SØ’£(@¹8€"€NÄãà@¹c  ¦@UüÐ'¿ä’@¹(”€¤à€<È¿à€¡ €Ä¿ä†€ÐHÿÿ€¢ /€ €¡ À(ÿÿÄãà€  "€=Ä¿äØ@-Ö£H€8Ŀ䀡 €Ä¿ä†€ÐHÿÿ€¢ @€ €¡ À(ÿÿÄãà€  "€+Ä¿äØ@-Ä£`€&Ŀ䀡 2€#Ä¿äÄ¿ð€ˆ I€Ä¿ä†€ÈHÿÿ€¡ *2€Ä¿äÀ(ÿÿÄãà€  "€Ä¿äØ@-®£x€Ä¿ä„ Ä# l€ Ä¿äÄãà€  €„ Ø@-¡£,„ Ä# pĿ䀠 € Ä¿à€  2€ ÄãàÄ¿ô€  2€Äãà„ Ä# lÄãà€  "€Ä lØ@-‹£”Ä l€  €JÄ p€  €GÄ d€  2€à h@UŽ Ð# d ’¿àÐ# h@¸¸” À$ „ € Ä$ à'¿ø@U Ð$ ’¿àà à# h@¸ª” À$ @¸ï Ð'¿Ü@¸Ú¿Üì'¿¸€¥ ê'¿¼ò'¿Àð'¿Ä€ø'¿ÈÄ €§$€Ä Ä „  Ä'¿Ì€Ä¿ÌÄ'¿Ì€Ä¿Ìè'¿ÌÄ¿Ì€ §l&€À'¿Ð„ §lÄ'¿ÌÀ'¿Ð„?ÿÀ'¿ÔÄ'¿Ø@¹ ¿¸Ä hÐ   @¸°€Äãà€  "€Ä¿äØ@-8£˜Ä¿ä€  "€Ä¿ô@¸¡Ä¿ô€  €@¸›@¸™@X’Р\®¿ý¥@¸ÅР\Ä dÇà‘è@¸Ÿ¿þðØã¿XØ’£¤@¸³®€ G@¸fСˆØ–’£¨ @,ДÇà‘è @Xr¨ ª¤ €²ÿý9€¢ (€¨@U0`'7FÐ'¿äÄãà€  €Ø’Ø@,ó£°Ø’£¼@¸¾@¸Ë¬¢ €ج ’£À@¸µ @¸ÂØ°’£Ä@¸® @¸»¦€¢ F€ئ d’£È@¸¤ @¸±Ø¢’£Ì@¸ @¸ª²€¤` ´"€¢ ÄN`€  P"€¢` Äãà€  € ² Ø’çl£Ð”–˜@,¸šÀ'¿¼„?ÿô'¿Àâ'¿Äð'¿Èì'¿Ìæ'¿Ðò'¿Ôò'¿ØÄ'¿Ü@¸‡¿¼ÄãàÐ'¿ì€  €Ù’Ø@,££üÙ’  @¸n ÄJ €  € †Ù¢ ’@¸e ÄJ †€  ¿ÿû’ÄHà€  <€„ Ä'¿à„!íò'¿èÄ'¿ðÄãà€  €€¥ Ù@,‚ €€¥ À'¿à@¸[Ð'¿è„!¤Ä'¿ðÄãà€  €€¥ ’Ù@,r  €¥ € À'¿ô@T| ¨’¿à¤@·§” ò% € ò% ä'¿ø@Tq Ð$ ’¿àä @·›” ò$ @·È@WÁª¿ÿR@·ôÇà‘èã¿ ÄN  ¢ €  R€ €  ,"€£,`€  D"€¢`€  E"€ ¢`€ F"€¢`€  W"€¢`€F€   €   Ä£à€  "€  Ù@,, 8  ÄL €  2¿ÿÝÄL Çà‘èã¿PÙ’ €@·¼ª€ G@·oСˆÙ–’ „ @+Ù”Çà‘è @W{´ ° „€@·z@Ws„€@·s@Wl„€@·l@We„€…,¢¸ lÿü)€€zÙ’ Œ@·» €)F Ä#à€  €†Ù @+à’†ÄL €  "€ÄHàÄL €  ;€ †àÄHà€  €ÄHà€  ;2¿ÿú†àÄHà€  ;"€À(à@·:¤Ù$ @·’ ¤€"€À,¿ü@SñÄ#àÐ'¿ä€  "€ÄL¿ü’Ù@+µ ¬ÄL¿ü€  € „ Ä'¿àÄ#àÀ'¿è€  "€À'¿èÙ@+¨ ¸€ À'¿èÄ#àÀ'¿à€  "€À'¿èÙ@+ž ÄÀ'¿èÙ’ Ì@·h †2€/Ä#àÄ#à€  €Ù@+ Ð@¶ü@Võ €ÿû½¢€€Ù’¡L@·O†€Ä#àÄ#à€  €Ù@+v¡@¶ã€ÿÄ#à€  €ûÙ@+k ì€ö€  €ÙÙ¡P@+b’Ù’¡d@·- Ä#à€  € Ù¡h@+V’@·2Ù¬’¡t@· ¦€Ì  Ò ¤@¶Š€€¤   €¤ &¿ÿùÒ *ªª@·’¢«„ ‡< …8 „ €‡( „ À…( ®$Ù’¡¨@· @· Ä#à¶"'lÐ# `€  €ÙÙ@+&¡¬Ù¦ ’¡¼¤ @¶ï º@¶û ÄO`²€  "€ÄL ÄO`€  :€   ÄL €  €ÄL €  :2¿ÿú  ÄL €  "€ÄL   @¶âÄL ¤€  "€ÄL ÄL €  :€   ÄL €  €ÄL €  :2¿ÿú  ÄL €  "€Ä#à@¶Ê Ä#ঀ  "€ æ'¿¼Ò `Ù”æ# \¡À–˜@*Þšæ'¿¼„?ÿä'¿Àò'¿Äì'¿Èî'¿Ìö'¿ÐÀ'¿ÔÀ'¿ØÄ'¿Ü@¶­¿¼Ä#àÐ'¿ì€  €Ù’Ù@*É¡ôÙ’¢@¶” Ù’¢@¶ Ù’¢ @¶Œ  € Ä#à€  €Ù@*³¢@¶ €(ÿþ_Ä#àÐ'¿ð€  €€¦ Ù”¢<@*£’€¦ € À'¿ô@R­ ´’¿à°@µØ” À& „ € Ä& ð'¿ø@R¡ Ð& ’¿àð @µË” À& @µø@Uñ¢¿þ’€Ä#à€  €Ù@*{¡x@µè€@µä@¶Çà‘èã¿ €¦`€ €¦`€€¦`€*€,Ù€ Ù€¦`€%€%Ùÿú¼“è ’¢T@µõ¢€ G@µ¨Ð¡ˆÙ–’¢X @*”Çà‘è @¶+¤@µé„$ 0€   €ÿý'èÿúŸ“è ÿþèÿú›“è @µ~¢`’@)ú ÿú”“è ã¿ 7F¢ÄãT€  €¤Ù’¢˜@µÅ¦€ G@µxСˆÙ–’¢œ @)â”Çà‘è æãTÄ`(€  €5Ù@DþÐ`(Ä`,  ¨€  €€¤ @DöÐ`, €¤ €ª @µyª @µv„@R €¤ €ª7€ˆ¡7ˆ¡ €†€Ù7†¡Ù’¢¤–”@µ˜˜@µZ€¤ € Ù@µU€Ù@R¢¬ªÙ’¢°@µ‚Ù’¢ä@µ~Ù@µ¢üÔ` ’Ö`Ø` @µuÙ’£@µqÙ@µ£4Ô` ’Ö`Ø` @µhÙ’£L@µd€¦ €ÕÚ,¬ ° œ7²¡D¨ /Ù’£`@µWÄ` € ¿ÿ€ Ù@µ!` Ä  ”§lÄ …( Ö€ÙØ ’£d@µFÄ €  € ÙÔ ’£pÖ @µ=€Ä`Ù’£|@µ7€Ä`@´Ó£„’@µ0Ä`€  € €  "€Ù€  "€Ù€ÙÙ@´Â£˜’@µ€@´»£¨’@µ€@´´£¸’@µ€@´­£È’@µ @Z€Ð`֠ٴؠ ’£Ø@µ”Ä  ÄH €  /€ ÙÄà„   €|Ä$àÄà† Æ$àè( ÙÔ  ’£ð@´îÄ  ÄH €  € ÙÄà„   €oÄ$àÄà† Æ$àè( Ù’£ô@´Ü”Ä`€  € ÙÄà„   €cÄ$àÄà† Æ$àè( Ù’£ø@´Ë”Ä`€  € ÚÄà„   €WÄ$àÄà† Æ$àè( Ú’ @´»Ä`€  € Ú@´U  @VZÐ`’”@´®€ÄàÄ`€  2€ ÄàÄ`†€  €ÚÆ`’ @´ž”Äà„   €3Ä$àÄà† Æ$àì( @´]â`€¤`¿ÿ7ÙÚ’ @´‹@´SÄãT€  €@´€€@´”Çà‘è  /@´¹’¿ÿˆÙ /@´´’¿ÿ•Ù /@´¯’¿ÿ¡Ù /@´ª’¿ÿ­Ú @´¥’¿ÿÑ—:`– à˜@ ›; ˜+ – ’"@ ÐJ ’€ ’ ÿ˜`“* ÐJà ÿ@ÒJà‘* ’ `ÿ —2 ’ ?#ÿ‘: Ãà Àã¿¿ô’ À. @³ô” ¿ô’@³Ø” ¤   ¿ô’  ÿÿÕ” ¤€€¤ @¿ÿú¿ô’ …, ¿ô…8 „¿ÀÄ/¿üÿÿÉ” ,…* ¦àÌ’€@³¾” ÄN €  €† € ÄN €  €† € ÄN €  €† € ÄN † €  "€†  ¨ è.¿ô’ ÿÿ¤” …* ¤ ’€@³š” ÄL €  €† € €ÄL €  €† € €ÄL €  €† € €ÄL † €  "€†  €¿ôè,€’ ¤ ÿÿ€” …* ’€@³w” ÄL €  €† € €ÄL €  €† € €ÄL €  €† € €ÄL † €  "€†  €¿ôè,€’ !¤ ÿÿ]” …* ’€@³T” ÄL €  €† € €ÄL €  €† € €ÄL €  €† € €ÄL † €  "€†  €¿ôè,€’ ,¤ ÿÿ:” …* ’€@³1” ÄL €  €† € €ÄL €  €† € €ÄL €  €† € €ÄL † €  "€†  €¿ôè,€’ 7¤ ÿÿ” …* ’€@³” À, FÄ£à€  €Ú 4@'Å’Çàèã¿€@.;  ?øœ#€ `¨@³' @³$„  ?øœ#€ ` @³@’@³Ž’@.*@³’@.'”’¿ð@.,Ä¿ð¿è’¿ðÆ¿ø„€Ä'¿ðÄ¿ôÆ¿ü„€Ä'¿ô@²Ï” €¦ € & @.¿è’ @.”’¿ð@.Ä¿ð¿è’¿ðÆ¿ø„€Ä'¿ðÄ¿ôÆ¿ü„€Ä'¿ô@²¶” € $ ¿ÿé9 £ÄÿþÍ’¿èÇà‘è” ÒJ €¢`€ –ÒJà€¢@ € ÒJà–à€¢`2¿ÿúÒJà€– – Ãà ” € ˜ÐJ – ’ Ð*à’`˜ –à€¢@ &¿ÿûÐK Ãà㿘!9'4Ä#èª#èÆ`„ €£( Ä`` ?øœ#€ `…( ¤’ÿÿß”ÄàÐÆ#è„ €•( Ä#è…( Ä`…( ÿÿÔ’Ä`ÆàЄ€Æ#è„ €…( ’ÿÿÊ”ÄàÐÆ#è„ €Æ`„ÀÄ%`ÄàÐÄ$#èÇàèã¿ 4† Æ  Ì'4 ÈàЪ19²¶¬¸¤#ô€¡ 2€ Ä#ô¢ â$àÐâ$¿ôâ$¿øÆ&#ôÄN €  -€„ Ä$¿ü¬ €Ä#ôÄN €  +€ÚÀ$¿ü¬ € Ä#ô@²Ù D€"€â$¿üÀ$¿ü€Ä#ôÄ#ô€  "€Ä¿üÄ#ôÄH €  €ˆ€¦`Ä¿ü€  2€2ÄàÐÄ¿ôÆ¿ø€ À"€ ÄàÐÄàÐÆ¿ô€ À"€ÄàÐÿÿ‰€ ÄàÐÆ¿ô€ À"€ÄàÐÄàÐÄ$¿øÄàЀ €€ÄàÐ…( ÄÄH €  -2€ ÄàÐÄàÐ…( ÄÄH €  € ÄàЄ Ä$àÐÄàЀ €&¿ÿîÄàÐÄàÐÄ$¿ôÄàЀ €"€%ÄàÐÄàÐ…( ÐÚ@±å’ T€2€ÄàÐÄàЄ Ä$àÐÄ¿ôÆ¿ø€ À"€ Ä¿ôÄàÐÆ¿ô€ À"€Ä¿ôÿÿJ€ ê$¿ôÆ¿ø€ À2€ê$¿ôÄàÐÄ$¿øê$¿ôê$àÐÄàЀ €2€ ÄàÐÄ¿ôÆ¿ø€ À"€Ê¢?ÿÄ¿øÄ$àÐÇà‘è?ÿ…( ÄÄH €  -2€´Ä¿üÄàÐ…( ÄÄH €  €¬€¦`€ † ÄàÐ…( ÄÄH €  -€† † €ÄàÐÄàЀ¦`…( Ä„€„ Ä&#ô"€(Ä#ôÄàÐ…( ÄÄH €  -2€!Ä#ôÄàÐ…( ÄÄH €  -€€§`"€Ä#ôÆ#ôº ¨ À# \´ ÄHࢀ  €¤ÄHà€  =€ ¤¢`ÄL`€  €¤ÄL`€  =2¿ÿú¢`¤Ä`€  €#® Ò#ôÄ#ô”$@@±´Ð €2€¤ @±”РÄ#ô„$@€ €€€¥ 2€ º ¨´€ ¤ „ Ä# \¨´€ €§`¤ ®àÄ €  2¿ÿâÒ#ô€§`€Ä \€  €4Ä Ô€  €Ú@±C XG’Ô <ÄàÐ…( ÖG@±š h@±eÐ#ôÄ#ô„€Ä&#ôÄàЄ Ä$àÐÇà‘è ?€¥ €{€§ ÄàЄ Ä$àÐÄL`€  "€7Ä Ä €  €„`4€\Ä àÌ4Ä Ô€  €$ÄàÐ…( „Ä¿üÄH €  -€ Ú@± xG’Ô <G h@±iÖ €Ú@± ¨G’Ô <ÄàÐ…( „Ä¿üÖH G h@±XØ @±#Ð#ôÄ#ô„€Ä&#ôÇà‘è ?€  €+ÄàЀ €€ 4ÄàІ Æ$àÐ…( 4Ä€Ä àÌÄ Ô€  €Ú@°Û ØG’Ô <ÄàÐ…( „Ö¿üG@±1 h@°üÐ#ôÄ#ô„€Ä&#ôÄM €  :€Ï¢ ?¢ :Çà‘è@°ðÐ#ôÄ#ô€¦à„€Ä&#ô2€ô&àÄ €  "€Àâ Ä Æ Ä àÇà‘è €4ÄàÐ…( ÄÄH €  -€ 4Ä#ôÒH ÿýø€2€/Ä#ô4Ä Ô€  €#7ÄàÐ…( ÄÄH €  -€ Ú@°–¡G’Ô <GÖ#ô@°ï h€7Ú@°Š¡ G’Ô <ÄàÐ…( ÄÖH GØ#ô@°ß h7„aLÄ&#ôÄàЄ Ä$àÐÇà‘è ?† Æ&#ôâH ÿýÂ’Ä#ôÄH €  €€¢ ÄàЄ Ä$àЀN€¤`:€M4ÄJ €  :€hÄJ €  :2€Ä#ôÄ#ôÄH €  € 4Ä#ôÄ àÌÈàЄ Ä$àÐÀ&#ôÇà‘è4À  ÌÀ&#ôÇà‘èÄH €  € 4Ä#ôÄ àÌÈàЄ Ä$àЀ%À&#ôÄàЀ €€4Ä Ô€  € 4Ú@°5¡\G’Ô <G h@°Ž–4â  ØÄM €  :2€ ¢ ?¢ :€ À&#ôÄàІ Æ$àÐ…( 4ÄÄ àÌÀ&#ôÇà‘è4Ä Ô€  € 4Ú@°¡@G’Ô <G h@°l–4â  ØÇà‘è ?Ä¿ü€  2€ÄàÐÇà‘è?ÿ† Æ$àТ …( 4ÄÄ àÌÇà‘è‚š ÿý›ž‚– ˜ š ÿý•žÑš– Ð’ Ðà” €¢ €” ’`€¢`G*¿ÿûРÃà ‘*`Ú Ãà ã¿ @LŸ ò"  ô" ÿÿãÐ$ Ä ‡( „ À‡8 †à„€…8 Ä$ À$ Ä @L‘( Ð$ Ä Ð •( @¯Ï’ Çà‘èã¿ @¯ÞÐ @¯Üèã¿ æ è à ŸÄ@°RÒ ê ‡* ÄÀ€  € À…- Ò „À¨  ŸÅ@€€€¤€„€ „  Ä €  2¿ÿóÒ €    Çà‘èã¿ ÿÿØ’„ †2€Ä Çà‘èã¿  ÿÿÍ’†¢€ €¤ €€¤`Ä Ä$ "€„ Ä Ä$`Çà‘è „ Çà‘èã¿ ÿÿ¸’€ °@ Çàèã¿ ê Ä Æ …( ¨ÀÄ ÿÿn‘( …* Ð&  „ €‡8 †à„€…8 Ä& Ä @L‘( Ä ¬•( @¯\’ €¥@€(ì& …, ¦„€¤  Äà€  "€¦àÐàà ŸÄ@¯áÒ …* †€Ä€€  € € À€„€†„à†Ä €  ¿ÿø€ ÀÄàÄ àÄà¦àÄ à€¤À*¿ÿáÄà@¯I‘èã¿ è ê ì à ŸÄ@¯¾Ò …*  Ä€€  €…-`Ò „ª  ŸÅ€€€€¤€„€ „  Ä €  2¿ÿóÒ €Ä ò$ ô$ ÇàèÄ „ Ä& ò$ ô$ Ä Æ € À€ÿÿŠèÇàèã¿ ’ÿÿ6ˆ2€Ä Çà‘è ä …( ª À" Æ „€¦  † à€¢€Æ& „€¨„ ¨Ä €  €,ì à ŸÄ@¯oÒ …* †€Ä€€  €Äà€¥€€€ À€„€†„à†Ä €  2¿ÿõÄàÄ Ä àÄ Ä àê% €¥€„€¨„ ¨Ä €  2¿ÿÙì Çà‘è ã¿ Ä Ð •( @®­’ À& Çàèã¿ ä Ä Æ …( ¨À€¤€€¢Ä €  "€¤ æ Ò ŸÄ@”€€Ä € €"€¤ Ä €  2¿ÿóæ ¤ €¤€*¿ÿëÄ ÇàèÃàÐ ÒJ €¢`€– ÐJ €¢ € ‘*`’" ÐJà–à’@ÐJà€¢ ¿ÿú‘*`Ãà ã¿ @®U’„ €"€„ Çà‘èã¿ |² |ÿþv•ê X”ÐJ јcì ÿÒ €¢`€ÐJ €¢ €‘*`– ’" ÐJà–à ÿÐ ’@ÐJà€¢ ¿ÿø‘*`Ãà ã¿ @®l’„ €"€„ Çà‘èã¿ |² ˜|ÿþK•ê!㿘@Jä P¶Ð&`¤ P¢ ¨  ¦ ª ® ° ¬ O€¤@$€ ÄÀÐ`¥, @JÝ’Ð&`¬$ ÄÀ€  "€ð&ÀÄÀ„  Ä&À„ÀÆ ˆàÈ  ÄHàÆ`Ä(À„ €€  @0„€Ð&ÀÄÀ€€  ÄÀ„  Ä&À„ÀÆ ˆàÈ  ÄHàÆ`Ä(À„ €  €P† Ä`ÄH€€   2¿ÿÍ¢`€¥à€€¤`€€¤`€’¿ÿÄ`ÄH €   €€¤`’¿ÿ@/ñ„"€<† €¢?ÿ"€9† ÄO¿ÿ€   "¿ÿ´¢`€   "€-¢`€€¤`€¤`€„ Ä`цaì„€ÄH¿ÿ„ ÿ…( Ä€€ˆ @€„ ¢$`€¤`€ „ Ä`„€ÄH¿ÿ„ ÿ…( Ä€€ˆ @2¿ÿö¢$`„ Æ`Ä(ÀFÄ£à€  "€ † Ú¡„@"PÒ`Çà‘è ¿ÿ…€¤@€  "€† Çà‘èã¿ ÄN`ˆ¢€  "€ÄI ÄN Ñ’ãì„ ÿÄ€ ÆN`†àÿÆÀ € À2€ÄI ˆ ÄI €  €  ÄJ „ ÿÄ€ ÆI †àÿÆÀ € À"¿ÿõˆ ÄI €  € ÄJ €  :€¤ @>°€Ä@“èÇà‘è ã¿ ÄN Ñ¢áì¤ „ ÿ…( Ä€€ˆ €€¤@…, ÆL`„€¢`…( † à0¤€ÄL`„ ÿ…( Ä€€ˆ ¿ÿõ…, €¤@€Çà‘è @ÄL@€  "€ä&`Çà‘è Çà‘è ã¿ @JÐ&`Çà‘è  Ð"`Ãà ”’ÐJ €¢ "€” ÐJ`€¢ "€ ” ÐJ`€¢ "€” ÐJ`€¢ €” ÐJ €¢ "¿ÿþ” ÐJ €¢ "¿ÿú” ÐJ €¢ "¿ÿö” ÐJ €¢ "¿ÿò” Ãà"€ Ö Ö"`Ð ÃàÐ" ã¿ Ä ¢ €¤@€ ÚÄ €¤@€ÚÄ ‡,`°²€@¬ä•è ¡ˆÚ’¡´@¬Ü” q¿ÿöÄ ã¿ €¦2€Ä`Çà‘è Æ € À"€Ä Çà‘è •( Ð @­-Ò`€ „`?ÿÇà‘èã¿ Ä €¦@€ ÚÄ „ Ä& Ä Æ € À6€À& Çà衼Ú’¡Ð@¬²” ‹¿ÿòÄ ã¿ @I| Ä ¢ ª€  € €¤`†† Äà¢`€  ¿ÿý†à€¤`€Úâ%`À%`@Ih‘,`Ð%`„ €¤`€Ä%` ¤ ¦ Ä`¨Ò €¤ @¬Š” ¨ ¦à€¤€&¿ÿøÄ`Çà‘è¡ØÚ’¡ä@¬{” ¢¿ÿãâ%`ã¿ @IE ¢ â"  À" @I? Ð$ ’â$ Ð @¬i” Çà‘èã¿ @¬Ð @¬Žèã¿ Ä #F„  Ä& Äcà€  "€Ä Ô Ú¡ì@!’Ä €  € Äcà€  €Ú¢@!’ÿÿáèÇàèã¿ Ä Ä# \@¬ì \Çà‘èã¿ %9Ä£ø€  2€Ä` ÿþ Ð$£øÄ` „ Ä&` @I.’Уøÿý”FÄ£à€  €Ú¨¢8Ú¢(@ Þ’Ä`€  €ÚÄ`¤ ¦ ÿÿÖ€’¤ @ ÑÄ`¦à€¤€&¿ÿ÷Ä`Ú@ É‘è¢<Çàè㿘@¬³¤ €¢?ÿ€Ð'¿üÿÿƒ¿üÇà‘è9Äãø€  €€¤ Ðãøÿük’¤€¤ €FÄ£à€  "€Ä  ’Ú¢@@ £”Ä  „ Ä$  Çà‘耦`€ Ú@«Ý¢l’ @ X”@¬ˆ¤€€¦`2€¤ Ú@«Ï¢€ G@yР@’”@ F Çà‘è €Ú@«À¢’@ < ÿÿР ÿÿz’¤Çà‘èã¿ Ä €  €FÄã4€  € ¢ã4Ðã4@!Ò €2€Ä`Çà‘è Ä`€  € Ð`@Ò €€Çà‘è Çà‘è Ú¢˜Ú’¢¨@«†”!6¿ÿàFã¿ @«³Ä €  €-¨Ѥ ¦@Ъ£ì¢@«§ˆ€€¡?ÿ€¥ €€¡?ÿÄLà’„ ÿÄ€Æ`ÆHÀ†àÿÆÀ€ À€ €¡?ÿˆ¡  €’"`¢ <¿ÿóÄJ`€¡?ÿ"€ „ ¤ ¢`Ä€  2¿ÿßЀ„ „ Çà‘耢 €€¢ € Ú€¢ € Ú€¢ €ÚbÀ‚@«EžÚb°‚@«@žã¿ @«cÄ` €  €ÿþÌÇà‘è Ú¢ÐÚ’¢ä@«"”!s¿ÿöã¿ !9Ä#ø€  € Ð#ø’ Øÿüˆ” ÿûgÐ#øÀ$#øÇàèã¿Æ Ѭ€Žà¢¨Æ'¿ô°¦¡ì€-€Žà€¦@€€¦€ÄN`„ ÿ…( Ä€€ˆ @€€¦€¨ €¥€ €¦€ÄM „ ÿ…( Ä€€ˆ @2¿ÿø¨ €¦€€€ŽàÄN¿ÿ„ ÿ…( Ä€€ˆ @€€Žà¢$`€¤@€ ÄLÿ„ ÿ…( Ä€€ˆ @2¿ÿø¢$`€Žà€)¤$@ €¥ ?øœ#€ `Ð'¿ø¤:€îÀ,  ² <´? ÄM ¶ "¸ &º >€  &€¨ ÄL   Ä, ¤ €Û€¤€¥€Ó®ÄL €  #€5ª$@  €¤"€ÌÄMàÄMà„ ÿ…( Ä€€ˆ "€ÅÄMà€¤† €€¤ÄMà„ ÿ…( Ä€€ˆ €…(à„€ÆL   …( €¤„€€ †  0ÄL „ ÿ…( Ä€€ˆ ¿ÿó…(à€¤:€ Æ, ÄL „ ÿ…( Ä€€ˆ ˆ2€¡ÄMàÆ, ¤ €“€¤€¥` €Ú’¢ì@ªà” €€€¥`ÄL €  ;"€ ò, €¥`"€ ò, ÄL „ ÿ…( Ä€€ˆ Œ€€¥`ò,   ¤ €v€¤€¥` €Ú’¢ð@ªÃ” €€€¥`ÄL €  ;"€ ú, €¥`"€ ú, ÄL „ ÿ…( Ä€€ˆ Œ€€¥`ú,   ¤ €Y€¤€¥` €Ú’¢ô@ª¦” €€€¥`ÄL €  ;"€ ø, €¥`"€ ø, ÄL „ ÿ…( Ä€€ˆ Œ€€¥`ø,   ¤ €<€¤€¥` €Ú’¢ø@ª‰” €€€¥`ÄL €  ;"€ ö, €¥`"€ ö, ÄL „ ÿ…( Ä€€ˆ Œ€€¥`ö,   ¤ €€¤€¥`*€&ÄMàÚ’£@ªk” €2€ÄMàÄL €  ;"€ ô, €¥`"€ ô, ÄL „ ÿ…( Ä€€ˆ Œ2€ÄMàô,   ¤ €¤€€¤ÄL €  ;€ €¤  €€¤ÄMà €¥Ä, ¤ *¿ÿÄL À, „ Æ¿ø¤ €Ä â „€€¤@€ £,`€¤`&€¢ €¤@&¿ÿü£,`Ä €¤@"€Ä Ä  €  €Ð @F¥’Ð% € â% @F•Ò  @©ÁÔ à% À%  â% Ä Æ Ò¿ø€@©¸”Ä „€Ä% €7€Ž Ä â „€„ €¤@€ £,`€¤`&€¢ €¤@&¿ÿü£,`Ä €¤@"€Ä Ä  €  €Ð @Fu’Ð% € â% @FeÒ  @©‘Ô à% À%  â% Ä ’Æ €@©ˆ”Ä † €Ž È „€Æ)† Ä „€Ä% €Æ Ä¿ôÄHÀ€  €Ä¿ô†Àш£ìÄHà„ ÿÄ€Ä(à†àÄHà€  2¿ÿúÄHàÇàèã¿  €Ä €  "€Ä Ð ¤&€@©Ž€¤€*€   ’Ð @©”€€  Ä €  2¿ÿñÐ Ä €  €Çà‘è Çà‘è   ° lŒ¬Ððô(Lã¿ €¦€¨ Çà‘è¤ æN ¬  ц ª¡ì€¤€"€† € à €¦€ à…(àÄ€À€€¤à!2€ž† æL † ¤ €š€ à€¤à"€€¤à-€¤à €„$à €  (€æL €!„ àÿ"€æL €¤à "€æL €„ àÿ€ €¤à""€† €¤à'"€† €„ àÿ"€z† €¤à>"€† € „ àÿ¤ €s€ à€q€ à€o€ à…( Ä€€ˆ Œ2€i† €¤à."€f† €¤à-"€c† €¤à_"€`† † €^€ à„ àÿ…( Ä€€ˆ Œ€ €¤à."€ æL €¤à-"€ æL €¤à_"€æL † €M€ àæL ¤ €I€ à€¤à'€…,à€¤à"€LÚ…,àæL † ©8 ¤ €<€ à€¤À2€æL † €6€ à¤ €3€ à€¤À€@ÚæL † ¤ €+€ à€¤à-€?ÚæL † ¤ €#€ à€¤à-2€† æL † ¤ €€ à€¤à-2€æL † €€ à¤ €€ à€¤à-€-ÚæL † ¤ € € à€¤à-† €€ àæL ¤ † € à€€ à¿ÿU€¤€€ à"€¤ Çà‘è£Ú’£$@¨o”!Ï¿ÿ²…,à£4Ú’£H@¨h”!Ý¿ÿ¾æL £XÚ’£d@¨a”!â¿ÿ¿æL £tÚ’£€@¨Z”!ý¿ÿÑæL ã¿@ô'¿¨„  ÀÄ'¿¸„ œ#€ö'¿¬¢¤ú'¿°€¦`Ä'¿¤€ `°!ø'¿´„!œ#€Ä'¿ì `Ð'¿è„ Ä'¿ôÑÐ'¿ø¦¡ìÆ¿ìÆ'¿üÀ'¿ð”$€@¨’’ <ª ´ ¬€ò¢ €¤@€ïÄJ €  !2€ ÄJ ÿþô’¢€¢2¿ÿëÀ'¿ð€ãÄ¿ô€  /€ ¢ €¤@€Û´  ÄL`„ ÿ…( Ä€€ˆ Œ2€¢`ÄL`€  ."€ ¢`ÄL`€  -"€¢`ÄL`€  _€€¤@¢`€¤@€ÃÄL`„ ÿ…( Ä€€ˆ Œ2¿ÿø¢`ÄL`€  ."¿ÿô¢`ÄL`€  -"¿ÿð¢`ÄL`€  _"¿ÿì¢`€¤@"¿ÿ´À'¿ðÄL`„ ÿ…( Ä€€ˆ @€ ¨¢`€¤@€¢ÄL`„ ÿ…( Ä€€ˆ @2¿ÿø¢`€¦ "€Ð¿¨ÄL`€  >2¿ÿš¢ Ð¿¨’ÿþl”€€¸ € „ ¿è’”¸ ÿüµ– „ ÆL`Ä'¿¼„àÿ…( Ä€€ˆ @"€ÄL`¢`€¤@€xÄL`„ ÿ…( Ä€€ˆ @2¿ÿø¢`ÄL`€  /2€ÄL`¢`€¤@€iÄL`„ ÿ…( Ä€€ˆ @"€ÄL`¢`€¤@€^ÄL`„ ÿ…( Ä€€ˆ @2¿ÿø¢`ÄL`€  >2¿ÿY¢ ÄL`€  >€&€§ ÄL`„ ÿ…( Ä€€ˆ Œ€¶ÄL`€  ."€ ¢`ÄL`€  -"€¢`ÄL`€  _€€¦À¢`€¤@€8ÄL`„ ÿ…( Ä€€ˆ Œ2¿ÿø¢`ÄL`€  ."¿ÿô¢`ÄL`€  -"¿ÿð¢`ÄL`€  _"¿ÿì¢`€¦À"¿ÿ(¢ ÄL`º„ ÿ…( Ä€€ˆ @"€ÄL`¢`€¤@€ÄL`„ ÿ…( Ä€€ˆ @2¿ÿø¢`ÄL`„ ÿ…( Ä€€ˆ Œ€Ž²ÄL`€  .€Š²ÄL`€  -€†²ÄL`€  _€‚²ÄL`€  /€~²ÄL`€  >€z²ÄL`€  =2¿þö¢ ¢`€¤@€ìÄL`„ ÿ…( Ä€€ˆ @"€ÄL`¢`€¤@€áÄL`„ ÿ…( Ä€€ˆ @2¿ÿø¢`ÄL`€  ""€+ÈL`ÄL`€  '€&²ÄL`„ ÿ…( Ä€€ˆ @€€¦@ÄL`€  >€€¦@¢`€¤@€ÃÄL`„ ÿ…( Ä€€ˆ @€€¦@ÄL`€  >2¿ÿô¢`€¦@"¿þ»¢ â'¿Ä„ ò'¿Àâ'¿ÈÄ'¿¼€8€§ ÈL`â'¿À¢`€¤@€¨† Ä¿À²ÄH € €"€ÄL`€ à€ € àÄL`€   €€ à¢† € ÄL`"€¢`ÄL`€  >"€ ÄL`¢`€¤@€ÄL`€ €¿ÿꀠàÄL`€ €2¿þŒÀ'¿ðâ'¿Ä¢`€¤@€€„ â'¿ÈÄ'¿¼€€§ ö'¿À€§ ú'¿Äú'¿È¿þô„ Ä¿¬€  €’ÿýK”€¿þê„ Ä¿¸®`€ €€ ¨©- €¥ &€¨ €¥&¿ÿü©- €¥€…-`Ä¿¤€  € …- „ €“( @Cq°€è'¿¸„ €@C`‘( Æ¿¸ …(à„ €•( @¦‰’À'¿¤°è'¿¸…-`è¿ð¿è„ €’…( ” ªè$ ÿûi– Ä¿ð¿è’Ä$ Ô¿ÄÿûbÖ¿¼Ä¿ÀÄ$ Æ¿È„ ÀÄ$ ¿þ©„ "€Ä¿è¢`€¤@*¿þ,À'¿ð€$Ä¿ôÄ'¿Ð€¥`ô'¿Ôê'¿Ø$€ð'¿Ü ˆÄ¿èÆ  €¢„€Ä! Æ Ä¿è„€Ä! ˆ &¿ÿöÄ¿èð'¿Ü `¿ÐÄ¿´¢ì'¿àà'¿äŸÀ€Ò¿°€¤*¿þ À'¿ðÄ¿ô€  2€Ä¿ø@¦mпèÄ¿øÄ'¿èÆ¿ü„ Æ'¿ìÆ¿¤À'¿ðÄ'¿ô€ à€@¦`Çàèã¿ @B÷ T3:4Ð&`¬ Ü1F  º`ä ¨ ª ®#@Ä#@€  €¢ Ä#@Ä €  €€¤`Ä#@¦ Ѐ@¦S’€€ ¦àÄ#@Ä€€  2¿ÿ÷Ä#@€€¤`¢ €¤`2€#¬ Äÿü€  €¦ ÄÿüÄ €  €€¤àÄÿü¢ Ѐ@¦7’€€ ¢`ÄÿüÄ€€  2¿ÿ÷Äÿü€€¤à¦ €¤à"€¬ Ä`  ¬ ä €ª`¨ €¥ &¿ÿÁä Ä`‡, À €@B¦ 4ˆ’¢lÄ¢lª† Ä" †à’` € à*¿ÿûÄ`µ(ல ¨ À!4° ม€¶à¬ 䀦 €€¥ Ð`¢ ¦%à @¥¸’€€  ¢`€¤@&¿ÿùÐ €€¥ ¬ €¥ € ¨ ° “.à¶à@B~ä"´ ªÀ"®à²`€¦` ¿ÿݬ ê'üÇàèã¿ 4¢ Рܤ Ü@¥Õ’€¢ 4€ ¢?ÿ€¤ ¢`€¤`*¿ÿ÷Р€¢?ÿÇà‘èã¿ Ä €  €¦ Ä ¨ Ѐ@¥¾’€€ ¨ Ä ¦à€¤À&¿ÿ÷Ä € €¦ €…,àæ& „ €Æ …( „ÀÄ Çà‘èÇà‘è ã¿ @6IÄ ¢€  €¬ê €€¥`ê €¥`€(/FÄãà€  €€¥ ÛÒ  Ä@”€¥ € Û@¥G è’Ô  @Á–Çà‘è @74’ ª€3FÄãà€  "€m® ÛÒ ¡@ì”Çà‘è @=ì’1F®Ä#à€  € Û”Ò ¡0–@Ú˜@7’ ª€Ä#à€  €ÛÒ ¡P@Ë”@¥8Çà‘è @¥4FÄ£à€  €Û¡x@¼Ò`@AÉ ®’ @¥ ” À%à….à€¥ ê%à„ €Æ  …( †ÀÆàÈ † ÀÆ%àÆ  „ÀÄ  Ä%à….`Æ à„ †(à„À€ Ä-àÄL`€  /€€¥ Ä à„ @Ä-à€ Ä €¥ "€Ä Ä à„  Ä-àÄ €  "€î' Ä î  î' Çà‘èî' Çà‘èã¿ 4¤´¡| ¢Ä ²?ÿ† ˆ€ €€ˆ †à€ à&¿ÿûÄ €€¦ÿ²€ ÿÿ€=ÛÄ €  €7….`¬ „ €¶ »( Ä ¸ ® „€€¦`ð 6€%®àÄ@€ €2€!®àÄ ¨¦ª@ÐÀ@¤ÕÒÀ€2€¨ ÄÀ€ˆ „ €„ ”’–ÿÿ&˜¨ €¥ €ª` Ä`¦à € €"¿ÿèÄ ®àÄ ¬ €¥€&¿ÿÕÄ Çàè¡”Û’¡ @¤i”!®¿ÿÁÄ 㿘Û”¿ü’¡¬ÿþ㤀#’ ”Ö¿üÿÿ˜†€Ä „ €Ä* Ä „ Ä* Ä €  "€Ä @¤}РĠ€  €Ð @= ’Ð& Çàè@A5Ð& Çàè㿘Û”¿ü’¡´ÿþ·¤€ Û’¡¼ÿþ¯” ¦€Û@¤p’¡À€"€ „ Û’¡Ì@¤i€€„ „ €Ö¿ü„ Ö¿ü’”ÿþ»˜Çàè㿘Û’¡ÜÿþŽ” Û¤’¡äÿþˆ” †€sѦ¡ìÛ@¤G’¡ð€€m€¤ Û’¡ø”¿üÿþy¤ ’€ÄJ ˆ„ ÿ…( Ä€€ˆ "€ÄI …, ÆI „€ˆ …( „€¤  0ÄI „ ÿ…( Ä€€ˆ ¿ÿõ…, ÄI €  ;€ƒÄI  „ ÿ…( Ä€€ˆ @"€ ÄJ  ÄJ „ ÿ…( Ä€€ˆ @2¿ÿû ÄJ Ò†`ì„ ÿÄ€€  U€kÄJ „ ÿÄ€€  R€eÄJ „ ÿÄ€€  L€_ÄJ €  =€[ÄJ † „ ÿ…( Ä€€ˆ @"€ Ö¿ü†àÄHà„ ÿ…( Ä€€ˆ @2¿ÿû†àÖ¿ü’ ”ÿþB˜†€BÄ „ Ä* ä" Çà耤 €9Û’¢@£Ó€€2Û’¢ÿþ” ¤€*¢Û@£Ä’¢€€„ Ä& ÇàèÄL €  €Û¦ ¨¢@£º’ ,„€¤ €’@£›¤@’”$€@£Ÿ€€¢æ& ÄL €  ¿ÿìÇàèã¿ ÿý½Ð ¢¤¦€¢?ÿ€ °…,à4†`à²à€Ä•èÛ¢$Û’¢0@£<”"\¿ÿô…,àã¿€ ¢@C˜¦€ G@£HСˆÛ–’¢< @²”Çà‘è -F/:ģਠªà€  "€ÄàÔàÛ¢D@ß’Äà€¤`Ä'¿äè'¿üè'¿ø€è'¿è€â'¿ìF⣘â'¿ìÄàà'¿ðè'¿ô€  2€ÔàÿüâÔà‡Öü˜ \ÐàÒàÿú©š¿äÄ£à€  €€¦ ÛÔ¿ô¢\@º’€¦ "€Ä¿èÄ¿ôÄ& Ä¿è€  €@£@CÂÄ¿øÇà‘èã¿ :Äà à€  "€Ä?ü@£ÐàÄ?ü€  €ð?ü@£ èÇàèã¿ ÛÀ&`’¢t@£” €€ˆ Çà‘è?ÿÄN Ñ–áì’ „ ÿ…( Ä€ €ˆ "€ÄI …*`ÆI „€ ˆ …( † à0’€ÄI „ ÿ…( Ä€ €ˆ ¿ÿõ…*`ÄI €  .€T€¢€R ÄI ”„ ÿ…( Ä€ €ˆ "€ ÄJ ÄJ ÆJ  †àÿ…(àÄ€ €ˆ 2¿ÿúÄJ ÄJ €   2€>†?ÿ€¢€"€;†?ÿ€¢`6€ÄJ Çà‘è?ÿ„ ÿ…( Ä€ €ˆ "€0†?ÿÄJ „ ÿ…( Ä€ €ˆ "€)†?ÿÄJ „ ÿ…( Ä€ €ˆ "€"†?ÿÄJ „  0‡( † À‡(à„€ÆJ …( † à0‰(à†‡(à„€ÆJ † à0†€ÄJ €   € „ ÄJ €  2€ †?ÿ„ Ä&`Çà‘èÄ&`Çà‘è†?ÿÇà‘èã¿ Û’¢| @¢Ž” ¢€€¤ ÄL €  :"€¤ ÿõ+ÄL€€  € €Çà‘è ÄL Ñáì„ ÿ…( Ä€€ˆ €† Çà‘è ÄL „ ÿ…( Ä€€ˆ "€ÄL …(à„€ÆL   …( † à0†€ÄL „ ÿ…( Ä€€ˆ ¿ÿõ…(àÄL €  -€G„ ÄL „ ÿ…( Ä€€ˆ €@„ Æ$`ˆ † ÄL „ ÿ…( Ä€€ˆ "€ÄI …(à„€ÆI ˆ …( † à0†€ÄI „ ÿ…( Ä€€ˆ ¿ÿõ…(àÄI €  /2€$„ ÄI „ ÿ…( Ä€€ˆ "€„ Æ$`† ÄI „ ÿ…( Ä€€ˆ "€Æ$`…(àˆ „€ÆI ˆ …( † à0†€ÄI „ ÿ…( Ä€€ˆ ¿ÿõ…(àÆ$`Çà‘è Çà‘èã¿ Û@¢k’¢„€€„ Ä&`Çà‘è À&`Çà‘è ã¿  @¢’ ;ˆ¢€€¡@¡ñˆ€¡€ÄI?ÿцaì„ ÿ…( Ä€€ˆ @€ˆ! €¡€ ÄI?ÿ„ ÿ…( Ä€€ˆ @2¿ÿøˆ! @>Ï’Ð$`Çà‘è ã¿ Û@¡à’¢Œ€€„ Ä&`Çà‘è ã¿ %:  ¢ à$`Ä €  €Fÿõ-Рà$ FÄ£à€  €Ûòø@A‘袘Çàèã¿ ³.`):³6`….`£0 Ä €  €¦ Äÿô€ €€'@¡}ÐÿôFÄ£à€  €ÒÿôÛ@&¢ÀÿÿÑÄÿü€  €ÿõ]’ Ð$ÿüÄÿü€  €Ûâ4ÿø„ ô$ÿôÄ% FÄ£à€  €Û°£@ “èÇàèÛ¢ÐÛ’¢è@¡@”!i¿ÿä¢ðÛ’£@¡9”!n¿ÿåâ4ÿøã¿ :Äà€  €³.`Çà‘è ³6`¢à….`Æø…0 € €€Çà‘è ÿõ&’ ¤2€ÐüÇà‘è ÿôD’ ÿôÀ€¤ €Çà‘è ÿÆ}Ðô€€@¡ÐôFÄ£à€  €ÒôÛ@È£8ÿÿsÇà‘è Çà‘è ã¿ Ä €  "€Ä @¡*Ð Ä €  "€Ä @¡$Ð Ä €  €„ @¡Ð „ À& Ä& Ä& Çàè‚~°ã€Ä ¤¨¬²° €ˆ 2€À'¿üÄ ,Ä €  €?ÛÀ'¿üF¦£|Ä£|ð'¿ø€  €€¦à€„ À# „€„ „ Ä# „„ Ä# Œ„ Ä# ˆÀ# À'¿ð„ †?ÿÄ'¿ô€¦`Ä$ Æ$ Æ$  Ä$ Ä$ Ä$ è# ”2€ò# ”Ä „€  €Ä ”РÄ  …( ÿÿt“0 €"€Ä ”Û@ ¬£hÄ ”’Ô Ö  @% :ê Æàd€ à"€!Ä Û£ˆ@W’€Ä Ð ÿô‘’ „€óÐ# Àà ”ÿÅ;Ð Ä à À…( “0 ÿÅÈ” ªÿÅ1 ÿô#€¥`€ÚGÄ €ˆ €7„¡PÄ# ˜€¶ 7¶ „¡XÄ# ˜Ä (€  "€Ä @ Ð (’ „  ?ø@¡” ÐÛ¶’£˜@ ÌÔ (Ä €ˆ €7„¡\Ä# œ€Ä 7„¡pÄ# œÄ €  ¸ €F@BžÐ ’ „  ?ø@¡” ÐÛ¸’£¨@ °Ô FÄ£ð€  €!7@ pÐàt’ „  ?ø@ ò” ÐÐ#  @ ŒÒàt€Ä (@ dÐ p’ „  ?ø@ æ” ÐÐ#  ÛÔ p@ “’£¼Ä (Ä'¿ì’¿ì”¿èà ,à'¿èÐ @u– Ŀ쀠 €ˆ€È'¿ìÈÿôÈ'¿ìĿ耠 €†€Æ'¿èÆÿøÆ'¿è¢ €¡ €® € à€® Ä¿ü€  € ’Û@ 産Ģ€® @3Œ Ð¿ü® Ò¿ìÔ¿èÖ ˜@ '˜¢@ €¦`€´ Äà$€  "€ Æ`(Äà(€  "€Æ`(Æà$Äà(Ä# À€€ àÄ`,€ àÄ# À€ ´ Ä À€  € ´ Û”£Ô´ @ ¸Ò À®@0ãÐ Ä € €€º @BÐ ’ „ ?ø@ |” ÐÛ´’£è@ )Ô Ä „€  €G7º¡tGÄ $€  € €¦`Ð Ò Ô ÿÌ– °€¦`€@<›Ð Ð# ¤€À# °@34Ð# ¤À# °€¦ "€À# ´@ŸÎÐ# °À# ´€§`"€À# ¸@ŸÇÐ# ´À# ¸€¦à"€À# ¼@ŸÀÐ# ¸À# ¼€¦ "€À# ¬@Ÿ¹Ð# ¼À# ¬€¤`"€À# À@Ÿ²Ð# ¬À# À€¥à"€À# Ä@Ÿ«Ð# ÀÀ# Ä€§ €F@Ÿ¤Ð# ÄFÄ£x€  €À# È@ŸœÐÿüÐ# È@Ÿ™Ð ˜ @Ÿ–Р¤ @Ÿ“Р  @ŸÐ Æ °„ €Û@ŸŠ£ìÆ ´„È ¸Ð ¼„€Æ ¬„€È À„€à Ä„€„€ €@Ÿ{РœÆ È’ „„„€ G ?ø@Ÿú” Ѐ¦ €Ð# ¨ô# ¬€€§`7€§`„¡Ä# ¬€7ú# °€€¦à„¡˜Ä# °€¦à€7ö# ´€€¦ „¡œÄ# ´€¦ €7ð# ¸€€¤`„¡ Ä# ¸€¤`€7â# ¼€€¥à„¡¤Ä# ¼€¥à€7î# À€€§ „¡¤€§ „ Ä# À€7ø# Ä€F„¡¤„ Ä# ÄFÄ£x€  €7ÄÿüÄ# È€7„¡¤„  Ä# È7Æ ¬„¡”Ä# `Ä °È ´Ä# dÆ# \È# hÄ ¼Æ ¸È ÀÄ# pÆ# lÈ# tÄ œÆ ÄÈ ÈÄ# |ÛÆ# x’£ðÈ# €Ú Ô ˜Ö ¤@ŸIØ  FÄ£à€  €€¤`Ü <@•Ò ¨€¤`€€¥à@žÿ€¥à€€¦ @žú€¦ €@žõ@žóР¤à ¨@žó”ÿÅh’€€ô€¦`€7„¡´Ä# À€Ü7„¡¤„ Ä# ÀÜ@ž² œ’ @-Ô ÀÀ'¿àº?ÿú'¿ä‚Ю ‚@Ä ¸?ÿ´ „¿ýÄ% ¶ @ ¬’®à„ €¥à€„ ‚Ђ@‚Ì‚@’ÿðt”€¢ €<€¢ ‚Ì‚@Ä`ÄH €  €4€¢ Ü’ Ä@M Ü@ž} È’@G ‚Ì‚@@žŸÐ`Ä¿à€  €€¦ @ž™€¦ €@ž”@žqÄàd€  €:Ü ì@’:Ä €  "€»† :Ä €¥@2€¶† ÿü¼Çà‘è €NFģ܀  €€¥à‚Ì‚@@žtÐ`¢À ’`@;´‚Ì‚@¶`Ò`@ž3”„ Ä.€€¥àÀ.€€Z‚Ì‚@Ð`‚È‚@ÿûP’Ð$ ¸€¢?ÿ€2‚È‚@Æ`ÄHà€  €  Ü@ž¡\@;Ð$ €F@;Ð$ FÄ£à€  €Fģ؀  € ‚ÌÜ‚@’¡pÖ` @”€ö‚ÈÜ‚@’¡xÖ` @w”€ì‚Ì‚@Ä`ÄH €  € Ü@í¡0@:ÙÐ$ € Ü@å¡D@:ÑÐ$ ‚Ì‚@@žÐ`€ÚÜ‚Ì‚@Æ`ÄHà€  €ÐFģ؀  "€ Ä¿ä– Ü’¡€@I”Ŀ䀠¿ÿ€FĢ䀠 2€Ä¿àÜ‚Ì’¡ˆ‚@}Ð`” Xÿð.–¿ä€€«Ä¿à€  €Ü‚Ì’¡˜‚@ˆÐ`”¢Œÿð–¿à€€›Ä €  €Ü‚Ì’¡¨‚@}Ð`”¡ ÿðÖ ˆ€€‹Ä €  €Ü‚Ì’¡´‚@}Ð`”¡ ÿïþÖ Œ€€{Ä਀  €Ü‚Ì’¡Ä‚@UÐ`”¢ ÿïî–€€kÄ¿ü€  €Ü‚Ì’¡Ð‚@}Ð`”¡ ÿïÞ–¿ü€€[Ä €ˆ €‚ÌÜ‚@’¡äÐ`ˆ‚Ä”¢T‚@ÿïË–€€€§ÿ‚Ä‚@Ä`€  €AÄ „¿ïÄ% €<€§ÿ€‚ÌÜ‚@’¡ôÐ`ˆ‚¸” L‚@ÿï­–€"€ Ä „‚¸‚@ú`€$Ä „€  € Ä¿ô€  €Ü‚Ì’¢‚@}Ð`”¡$ÿï“–¿ô€€Ä¿ð€  € Ü‚Ì’¢‚@ˆÐ`”£0ÿ¿ð‚Ì‚@@2Ð`¿þk®à@.Ü’¢@Í Ä¿ä€ ¿ÿ"€Ä Ä¿ô€  €Ä¿ð€  "€Ä Ä „€  €Z„ Ä# Ä €  € €§!‘Ä ”РÄ  …( “0 ÿûc”€§!‘€ZÄ¿ü€  €WÄ¿à€  "€À'¿à@À'¿àÿûÒ@œÞFÄ£à€  €:Ü¢@@‡’:Ä €  "€ Ä¿ø:Ä €¥@2€Ä¿øÿû(Ä¿ø€  €+Ü@ §Ð¿ü€€Ð¿üÜ’¢ˆ@œé” €€„ Ä¿üцáìÄH „ ÿ…( Ä€€ˆ @€Ä¿üÄH €  €Ü„ Ä'¿ø¿û×À# @œÆпüÜ@œ™¢h’@c Çà‘è 5Ü@œ‘¢P’@[ @œ¶Ð¿üÇà‘è 5Ä¿ü€  €€§ È@œ®À'¿ü€§ È€ €§!-€§!,€€§!-Ä €§!-„ Ä% €€§!.€€§!,2€ Ä¿à€§!,2€.Ä Ä €  2€*Ä Ä „ Ä% Ä¿à€  €Ü@œ¢Ø”пàÜ@œ”’¢Ì€2€Ä Ä „ Ä% €ÄàœÄ „¿þÄ% Äàœ€  €-€§ÿÄ €ˆ €)€§ÿÄ ,Р@œþ’ . €Ü@œ’¢ä€€€§ÿÜ’¢ì@œz€€€§ÿÄ ,@œbРÄ , Р@9’ Ä ,Ð  Ä ,Ä €Ü@œy’¢ôÄ €§ÿ„  Ä% 2€oÄ ÄÿÜ€  "€nÀ$ Ä €  €8ƿ䀠ÿÿ"€6Ä $Ä € €&€2Ä $Ü@œ¢ü’@Ú Ä¿äÄ$ À$  Æ „àÄ% Ä¿à€  €€¦ @œ+€¦ €@œ&@œÄàd€  €:Ü£8@­’:Ä €  "€M† ):Ä €¥@2€H† )ÿúNÇà‘è )Ä $€  "€0À$ Ü@›Ý£HÄ ,’Ô @W Ä¿à€  €€¦ @›ü€¦ €@›÷@›ÔÄàd€  €:Ü£¸@~’:Ä €  "€† (:Ä €¥@2€† (ÿúÇà‘è (€§@€M€§ ÎÄ €  € Ŀ䀠¿ÿ€„€Ä'¿ä€Ä¿äÄ¿äº?ÿÄ$ ÄÿT€  "€GÄ¿àÄ €ˆ "€CÄ¿àÄà\€  2€?Ä¿àÜ@›–£Ø’@` Ŀ䀠¿ÿ"€Äÿh@=•’@W €§ÿ"€Æ¿àÜ@›„£äÄ¿ä @=ˆ €”’@û €Æ¿à€  €Ü@›u£ð„€ Ü@›o£ø„ @8’Æ¿à€ à€Ý’ ”@⠀ĿàÝ’  @* Ä¿à€  "€À'¿à@›À'¿àÄ €ˆ "€ÉÀ$ Ä €ˆ 2€ÅÀ$ ÄÿØ€  2€CâÿØÄ ,@0iРÄàp€  "€Ä Ä ,@0РÄ €  €7„¡¤† $€Ä ,„¡¤† (Ä ,Р@›‰’ €;G@›<СˆÄ ,–Ô Ý’  @¥ @›-Äàd€  €:Ý (@×’:Ä €  € €¦ :Ä €¥@€€¦ ÿùx€¦ "€m† @›5Çà‘è Ä  €  €):GÄ 0€  € ):@›f@›g@›h’ Ä ` „ ÏÄ,` ):Äà`¢ €  "€Ä¿ä’ ”@›¥–Ä¿ä† € ¿ÿ€†ì ‚Є  Ä# `‚@ì# \šÖ ’”@&˜Ð$  Ä  €  €Ä €  2€-ÄÿØ@š×Äàd€  "€Ä Ý 8@’Ä €  "€ÄÿØÄô€¥@2€ÄÿØÿù$€ÄÿØ@šÁÄàd€  "€Ä Ý H@k’Ä €  "€ ÄÿØÄô€¥@2€ÄÿØÿùÄÿØ€  €@šý„€€ ¿ÿ@›„€ ¿ÿ€€¦ „?þÄ$  "€Ä  @š»Ä  € ¿þ2€í† *Çà‘è À$  Ä¿à€  €€¦ @š®€¦ €@š©@š†Äàd€  €:Ý @0’:Ä €  "€Ð† *:Ä €¥@2€Ë† *ÿøÑÇà‘è *Ä¿à€  €€¦ @š‹€¦ €@š†@šcÄàd€  €:Ü£È@ ’:Ä €  "€­† /:Ä €¥@2€¨† /ÿø®Çà‘è /€  €ÜࠀĠ@š<¢ Ä  €  €Ü@š5¢¬¢€Ü7„¡¤¢  Ü@š,¢’ ”@¦–@š.Äàd€  €:Ü¢¼@Ø’:Ä €  "€ Ä¿à:Ä €¥@2€Ä¿àÿøyÄ¿à€  €€¦ @š5€¦ "€h† @š0Çà‘è Ü’ ü@ Í Ü@™ý¡ G@šСˆ’”@t ‚Ì‚@@šÐ`Ä¿à€  €€¦ @š€¦ €@š@™ìÄàd€  €:Ü¡ @–’:Ä €  "€6† !:Ä €¥@2€1† !ÿø7Çà‘è !Ü@™Ê h G@™ÕСˆ’”@A @™ÉÄàd€  €:Ü Œ@s’:Ä €  "€† 7:Ä €¥@2€† 7ÿøÇà‘è 7Ä¡ˆ€  ’€† † Çà‘è† Çà‘è£HÛ’£`@™’”"i¿ø¿À'¿üÜ¢ Ü’¢8@™Š”$A¿ü¢„ H,,ÜH,ÜÜÜÜÜÜÜ,ÜÜÜÜÜÜÜÜÜÜÜÜÜppÜÜ,,ÜÜÜÜÜÜH¤Ì,ÜÜÜ,ÜÜÜÜHHÜ,ÜÜHã¾°À'¿¦¸º² ò'¿ Gò'¿ü ¢ $Ä $®¶?ÿ¬?ÿ€  "€À'`Ä`€  "€ À'`):Ä €  2€À'`ÿƧÐ`„ Ä% À'`Ð @™y’ *€€ €¦ Ý@™. X’@ ø €¦ € €¦ Ä €  €€¦ ô'¿ø€Ä(€@/æÐ& ô'¿ø€Ä(@/àÐ'¿ü„¿üÄ'¿øÄ(€  €Ä¿øè €à'¿ôè(à'¿ôÄ¿ø@™5РÐ'¿$ ?øœ#€ hÐ'¿(Ä~耠 €/Ä¿ø@7<Р€€+´ Ý@˜ö „Ä¿ø’Ô @ p Äà„ Ä$àÄ¿ø@8éР "€Ä¿üÝ@˜â’ ´€€Ý’ ¼@˜Ü€2€Ä¿üÄà„ Ä$àÄ¿ü€  "€û„ "@˜ýÇà‘è "´ ÄÀ€  €4¤ À'¿,ÄÄ€  "€Ä¿,ä¿(Ä¿øà¿$Ò @˜º”Ý€’ À@˜µ” ’¿D@™0€2€Ä¿,ä'¿„ Ä'¿,Ä¿,€  2€ Ä¿Ä¿øР@™"’¿D€2€Ä¿Ä¿øÄ Ä'¿Ä¿€  €¤ Ä¿t´ ² ö¿„¤ Ä'¿ „ ¤ Ä$à@'O@6 Ä~¬€  "€ Ä~ü @1W’ ª¿4Ý@˜×’ È€¤ € ÝÝ@˜€ Ô’¿4@˜â”ݘ¿4’ à ”–@ óš@˜œÄ~ü€  € €¦ €€¦`"€ÄàÄà„¿ûÄ$à€€¤ Äà€¤ „ Ä$à€À'¿ÔÄà€ˆ €Ä4€  "€À'¿ð@6•€"€À'¿ð’¿D@˜Ç€2€ À'¿ðÄ¿X<„€ € €2€À'¿ðÄ¿tÄ'¿ÔÀ'¿ðÄ4€  € €§ Ä¿Ô€  €€§ „ Ä'¿ð€§ €€¤ 4€ÄàÄ`€  2€ÄàÄà„ Ä$à€’¿Ì„¿÷Ä$à’¿Ì”ÿ÷7–Ä(€  €°Ä¿øè €è(@5— Ŀܪ€  €@4ÿÐ'`„& ˆc„€  9€2…( Ä€À€ÿöÿ¿ÌÒ~´@&u€µÄ~´ÿöø¿ÌÄ¿ü€  "€„@˜!Çà‘èÝ’ ü@ ¾ Ý@—î¡ G@—ùСˆÄ¿ø’–Ô @ c ÿöÝ¿ÌÄ¿ü€  "€„@˜Çà‘èÝ’¡@ £ Ý@—Ó¡ ’@ O ÿöÉ¿ÌÄ¿ü€  "€ð„@—òÇà‘èÄ¿Ü€  €Ý@—À¡HÔ¿è’@ ; ÿöµ¿ÌÄ¿ü€  "€Ü„ %@—ÞÇà‘è %ÿö«¿ÌÄ¿ü€  "€Ò„ @—ÔÇà‘è ÿö¡¿ÌÄ¿ü€  "€È„ "@—ÊÇà‘è "Äà€ˆ €›€¦`€!€¦ ÄÀ€  € Ä¿à€  € Ý@—¡”’@ Y €€¦ Ä¿à€  €€¦ @€¢?ÿ¬€ €¦ Ý@—}¡Ð’@ G €¦ €=€¥¿ÿÄಠ´ „¿ûÄ$àÄ¿à€  €0¤ €¥¿ÿ€-€¦À€€¦ÀƿЀ ÿÿ€Ä¿ € €€€¦ÀÝ@—^¢’ @ ÙÔ¿ÿöS¿ÌÄ¿ü€  "€z„ "@—|Çà‘è "€ Ý@—L¢H’ @ ÇÔ¿ €Ý@—C¢|’@  ÿö9¿Ì€òÄ~´"€,Ä~üÄ~ü€  2€(Ä~üÈ¿ÐÆ¿Ì€ À€Ä¿Ø€  2€ Ä~ü€¡?ÿ"€ Ä(€ À&€Ä~üÄ~¼€  2€Ä~üÄ(€  € † Ä,€  €€ àÆ(€€ àÄ¿øÆ € à"€Ä~ü@5’Ä~ü€  €Ä¿ÌÆ¿ÔÒ¿ì €@"ù” È¿ÐÆ¿Ì€ À€Â°Ä¿Ø€  €Š€¡?ÿ€W€ À€Ý@–ù£0’Ø¿Ì ”@ r–Ò~´@%dÿõé¿Ì€¢Ä~´Ä~¼€  €Ý@–棤’Ø¿Ì Ú¿Ð”@ ^–Ò~´@%PÿõÕ¿Ì€ŽÄ~´Ý@–Õ£\Ä¿Ð’ Ú¿Ì”–Ä# \@ K˜è# \Ý ä# `’£€ÖàØ¿ÌÚ¿Ð@ A”Ä°„ Ä$°@%AпÌÄà€ˆ  € @3#’€ @3’ÿõ«¿ÌÄ¿ü€  "€Ò„ "@–ÔÇà‘è "Äà€ˆ "€Ä°Ý@–¡¢ðÚ¿Ì’ ”–@ ˜ä# \Ý Öà’£”Ø¿Ì@ šÄ°„ Ä$°@%пÌÄà€ˆ  € @2ò’€ @2í’ÿõz¿ÌÄ¿ü€  "€¡„ "@–£Çà‘è "€Ý@–s£Ô G@–~СˆØ¿Ì’”š @ ç–Ò~´@$Ùÿõ^¿Ì€Ä~´Ý@–^£ü G@–iСˆØ¿Ì’”Ð# \ Ú¿Ð@ Ñ–Ò~´@$ÃÿõH¿ÌÄ~´€  "¿ý´¤ Ä~´€¤€¿ý°¤ Çà‘è ,Äà€ˆ "€Ä°Ý@–<¢¨Ä¿Ð’ Ú¿Ì”–Ä# \@ ²˜è# \Ý ä# `’¢ÌÖàØ¿ÌÚ¿Ð@ ¨”Ä°„ Ä$°@$¨Ð¿ÌÄà€ˆ  € @2Š’€ @2…’ÿõ¿ÌÄ¿ü€  "€9„ "@–;Çà‘è "ÝÔ¿èÖ¿ä’¢ @ ˆ Ä¿ü€  "€+„ "@–-Çà‘è "Ä~¬€  €Ý@.Æ’ Ý ’¡t @ s”@–Ý@•ï¡|’Ö¿è Ø¿ä@ h”Ý’¡@ ² ÿôÞ¿ÌÄ¿ü€  "€„ %@–„ %Çà‘è@–¿þ;Äà㿘@–e€¢?ÿ€ Ð'¿üÄ „  Ä& @–]€¢?ÿ€„.Çà‘è?ÿÄ'¿ü@–|¿ü @–RÀ" €¢?ÿ€ †Ä „  Ä$ @–J€¢?ÿ€†.Çà‘è?ÿÄ¿ü† À„ €Çà‘è”2€ÒJ Ãà ’ `ÿÑ“*`–!ìÒ@ €Š`@"€ ÐJ ” ÒJ ’ `ÿ“*`Ò@ €Š`@2¿ÿû” ÐJ €¢ € ÐJ €¢ G2€ ÐJ ÐJ €¢ M2€ÐJ ÐJ €¢ T€ ÐJ €¢ +"€ÐJ ÐJ €¢ -2€  ÐJ  ÿ‘* Ð €Š € Ãà Ãàã¿xÀ'¿ü4¢ ¤¢|Ò ”¿Ü@–)ÿÿ¿€€¤ ¢`€¤`*¿ÿöÒ Çà‘è?ÿÿÿŒ¿ÜÇà‘è– ˜ š $€$à”4„"ŒÐJ ‘: š`ÐJ€£@ Ð+ ÐJ  “* ÐJ ‘: @ÐJÐ+ ÐJ  “* ÐJ ‘: @ÐJÐ+ ÐJ ”  ?ÐJÐ+ ˜ &¿ÿåÐJ à€£@€ =Ð+?ÿÃàÀ+ à€£@€ =Ð+?þÐ+?ÿÃàÀ+ 㿘@•J @•G *ªª¤ ¢ @•£’¢«„€  ‡<  ?ø…8 œ#€„ € `­( Þ ’ h”@•j–  ?øœ#€ `¤’ÿÿ£”@•&„  #Þ@1¿€°’`p”@•V–Çàèã¿ @•”@•+’ ¤€€K@• ÄL€  €¤Çà‘è?ÿÿç±ÄL€€  =€†€Çà‘è?ÿÄHà€  €¤àÇà‘è?ÿÿç£ÄL€€  "€†€Çà‘è?ÿÄHà€  €¦àÇà‘è?ÿÄHऀ  "€ÄL ÄHà€  "€ ¤ ÄL €  €ÄL €  "2¿ÿú¤ ÄL €  2€Ä Çà‘è?ÿ€  €@”ÇР@1À’„$€Ð& „ Çà‘èÇà‘è ”Ð `– ‘: €¢ 6€Ð `Ð `‘:  0€Ð* ‘:  WÐ* Ð ` €¢ 6€Ð `Ð `  0€Ð*   WÐ* –à’`” €¢à&¿ÿãÐ `ÃàÀ* ã¿ ¤9:¦„ ´ ¢Ä& Ä& Ä' ÄN €  €‰¨4ª ¶¢Ð4º¢Ìÿç6¬ ®ª@Òà°² Ô ÿÿi€¢ €b€ ° ¬ ®à²€¥ *¿ÿôÒà€€¦`ª@€¦`2€:ÄM`ÄM`€  "€ÄM`ÄM`€  =€ ª`ÄM`€  €ÄM`€  =2¿ÿúª`ÄM`€  "€%ÄM`ÄM`ª`€  "€ ÄM`ÿçª@ÄM`€  "2€ÄM`ÄM`ª`€  "€ÄM`ÄM`€  "€ ª`ÄM`€  €ÄM`€  "2¿ÿúª`ÄM`€  2€ª`ÄM`€  "€ÄM`ÄM`€  ,€ ª`ÄM`€  €ÄM`€  ,2¿ÿúª`ÄM`€  2€ª`ÄM`€  ¿ÿ—€Ä Ä €  "€Ä @”Ð Ä €  "€Ä @” РĠ€  "€É  @”РÇà‘è Ä €  "€°Ä Ä €  "€¬Ä €¤`"€©Ä €¤à"€¦Ä €¤ "€£Ä €¥ "€ Ä @þ  ?øœ#€ `@þ @“é’@û”Þ’  ˜@ö”@“ÞÐ ’Ð @ð”Þ’  œ@ë”@“Ó’@å”’¿ð@ê¿Ìÿÿ ’¿ð@Ú@“Å’@×”Þ’   @Ò”@“º’@Ì”’¿ð@Ñ¿¨ÿþò’¿ð@Á¿Ì’ @À”Þ’  ¤@»”@“£Ð ’Р@µ”Þ’  ¨@°”¿¨’ @¬”’¿ð@±¿„ÿþÒ’¿ðÄ €  €¦ @“ŠÐ ¦@“‡ @“„ @“Ð  @“~Р @“{„„€@0  „¿„Ä# \ Ö ޔؠ’ ¬@“¦šÄ €  €Þ@“gÞ¢’¡@“×Ò @“ÔÞ’¡@“ÐÞ’¡@“ÌÇà‘耠 "€Ä @“MÐ Ä €  "€Ä @“GРĠ€  €  @“AРÇà‘èã¿ Þ’¡@“E” €€ÑÄN †aì„ ÿ…( Ä€€ˆ @2€1„ ÄN €  "€-„ Þ’¡ @“1” €€ÑÄN †aì„ ÿ…( Ä€€ˆ @2€„ ÄN €  "€„ Þ’¡(@“” €€ÑÄN †aì„ ÿ…( Ä€€ˆ @2€ „ ÄN €  €„ Çà‘è „ Çà‘èã¿ Þ’¡0 @“” ¢¤¦ª €€ ÞÞ”¡8ÿý¢’ªÞ’¡H@’ð” €€Þ°´¡Pÿý•“èÞ’¡`@’ä” €€°²´ÿþ:—èÇà‘è:Ð`€¢ €‚Ð`ÿæ;žÃàã¿ 4  ¢ R¤¢ä„‡0 „€§8 …,à„ €…( Ò€@’Ë€¢ € 6€ à¢$à€€¤€¤¿ÿî„Çà‘è?ÿÇà‘èFã¿ „c€’  ¿P¢ @’†”!`â$!T„?ÿÄ$ Þ@/\¡hÐ$ @„ Ä$ „ Ä$ (Þâ$ 8@/S¡lÐ$ ŒÞ@/O¡xÐ$ Þâ$ ”â$ ˜â$!0â$ ¬â$ °@’ý¡€„"€â$ ´@/„Ð$ Äâ$ ´„#„Ä$ Ø„$â$ èâ$!,Ä$!8„ Ä$!@„ 2Ä$!<Çàèã¿ Þ@’æ¡Œ„€€  @’ÿ@“†€ Ä €  € Ä €€  €@/‘èÇà‘è ã¿ Þ  @’Ê¡”¢€ ÄJ €  € @0\€€+G@/‘èÿÿÒ¢€€¤`@’= Þ@’9¡¬„@.Ó Þ ’¡´@’j”€¤`€€¤ @’)€¤ €Çà‘è @08€€„@’„ Çà‘è@‘ýСˆGÔ <G˜ hÞ’¡œ@’E–@‘Ô @.Ï‘è㿘G/Gª hÞ’¡À@’0¦€Þ@‘Ô¡Ä G@‘ßСˆÔà<’˜@’*–Çàè-:„ Ä% $@1è¤  €1’¿ü”¿ø@^¨@‘䀥 €Ð¿ü@ Ò¿ø€€ Þ@‘¯¡à’Ôà<–@’ ˜@‘Ñпü@‘Ïпø€¤ €¥ 2€ ¤ Þ@‘¢’Ôà<–@‘÷˜¤ @1¹ ¿ÿÓ’¿üÀ% $@‘ëÇàèã¿ ÿÿ Þ@/¢ €€Þÿÿ¢4ÿÿR €Þ@‘r’¢H€€ Þ@‘p¢\G’Ô <G h@‘É–@‘‘‘èÿÿ†@‘‘èÇàèã¿ Ñ ª¡ìÄL ¦¢€  "€ÄLàÄL „ ÿ…( Ä€€ˆ @"€ÄLà¦àÄLà€  € ÄLà„ ÿ…( Ä€€ˆ @2¿ÿ÷¦àÄLà€  €•ÄLà€  #€‘ÄLà„ ÿ…( Ä€€ˆ ˆ€ ¨ÄLà€  _"€¦àÄLà€  -2€ÄLà¦àÄLà„ ÿ…( Ä€€ˆ ˆ2¿ÿû¦àÄLà€  _"¿ÿ÷¦àÄLà€  -"¿ÿó¦àÄLà„ ÿ…( Ä€€ˆ @€„$ÀÄLà€  =€„$ÀÇà‘è @-Ø Ð$`€¥Æ`€ÄM €  _"€ ¨ ÄM €  -"€¨ ÄM ¨ Ä(à†à€¥*¿ÿôÄM À(àÿþ^Ð`€¢?ÿ2€ÄLà@‘Ð`Çà‘è „ ÿ…( Ä€€ˆ @"€ ÄLà¦àÄLà„ ÿ…( Ä€€ˆ @2¿ÿû¦àÄLà€  ="€ÄLà@‘Ð`Çà‘è „ ÿ…( Ä€€ˆ @€ ¢à¢`ÄL`„ ÿ…( Ä€€ˆ @2¿ÿû¢`@÷„†  € À€’àÄH¿ÿ„ ÿ…( Ä€€ˆ @€’à† à€ À€ ’àÄHà„ ÿ…( Ä€€ˆ @2¿ÿø† à’à@-ÖÐ& Çà‘è Çà‘è?ÿã¿ ¢€ ¤€ÿþ €¢?ÿ€Þ@ž¢˜G’Ô <G– h@ö˜Çà‘è …* 4„ €†bè…( ô€4†âìà€ÄèÇà‘è ã¿¿ð’ @”” ÿäy’ ¦€Þ@z¢ÄG’Ô <G– h@Ò˜Çà‘è ”¿ôÿãt’ ÿä „ Ä7¿ðÀ7¿òÄ €  €@ŒÐ @-* Ð& ’¿ðР@U” Çà‘è ã¿ Þ’¢ô@“€€%„ ÄN`€  1€ÞÄN`€  €„ Þ’¢ø@„€"€„ ÄN`€  0€ÞÄN`€  "€„ Þ@7¢üG’Ô <G h@–Çà‘è Ä& Çà‘è ã¿ Ä € ¿ÿ€TÄ €  €PÞ’£ @^€€G„ ÄN`€  2€ÞÄN`€  €?„ Þ’£(@O€"€8„ ÄN`€  1€ÞÄN`€  "€0„ Þ’£,@@€"€)„ ÄN`€  0€ÞÄN`€  "€!„ Þ’£0@1€"€„?ÿÄN`€  -€ ÞÄN`€  1€ÞÄN`€  "€„?ÿÞ@à£8G’Ô <G h@9–Çà‘è Ä& Çà‘è Çà‘è ã¿ @n€¢?ÿ€Þ@Æ£lG’Ô <G– h@˜Çà‘è Ð& Çà‘è ã¿ Þ’£”@ó€€À& Çà‘è ÿÿàèã¿ Ä €  €@ÏР@,‘Ð& Çà‘è ã¿ Ä €  €:@ÃР:Ä $€  €=ÄN`€  ~€9ÄN`€  /€5ÿýGª ¨€0@²ˆ¤"€ÄN`†ÄHÿÿ€  /2€ ÄN`† त €ê(àÄHÿÿ€  /¿ÿû† àÄN`€  /€ª`ª`ÄM`€  /"¿ÿþª`@–„ @,0€ ’@\”„ /Ä,„ @­’à& Çà‘è @,EÐ& Çà‘è ã¿ ÄN`€  € @,~’@0;РÐ& Çà‘è @0#РÀ& Çà‘è ã¿ ÄN`€  €'¨ @,l¦"€Ð Ä €  €¢Ð`@^€¢ $€ ¢„`Ä`„€ÄH¿ÿ€  /2€¢„`Ä`¢„`„€è(¿ÿ€Ä`€  2¿ÿíÐ`Р@0 ’Ð& Çà‘è @/ôРè& Çà‘è ã¿ ÄN`’ €  i€ÄN`€  n2€ÄN`ÄN`€  f2€ ÄN`ÄN`€  2€ÄN`À& Çà‘è ÄN`€  €€¢ÄN`Ñ”áì„ ÿ…( Ä€ €ˆ €€¢…*`ÆJ  „€ …( † à0’€ÄJ €  € €¢ÄJ „ ÿ…( Ä€ €ˆ ¿ÿñ…*`€¢€/ÞÄJ €  "€ÄJ ÄJ €  €'ÞÄJ цcì„ ÿÄ€€  k€ €  "€Ò& €  g"€ “*`€ Þ"€“*` €  m"€“*`€Þ€ Ò& € Ò& @Ž·£¸’@}”Çà‘è Ò& Çà‘è @Ž­£˜’@s”Çà‘è ã¿ ÄN`’ €  €€¢ÄN`Ñ”áì„ ÿ…( Ä€ €ˆ €€¢…*`ÆJ  „€ …( † à0’€ÄJ €  € €¢ÄJ „ ÿ…( Ä€ €ˆ ¿ÿñ…*`€¢€GÞÄJ €  "€ÄJ ÄJ €  €?ÞÄJ цcì„ ÿÄ€€  m€ €  "€2Ò& €  d"€…*`€  h"€…*`€#Þ"€…*`€  w"€…*`€Þ„ € “( €Ò& „ € …( „@“( €Ò& „€ …( „ € ‡( „À“( €Ò& „ € ‡( „ À‡( „À“( € Ò& @ŽE£ø’@ ”Çà‘è Çà‘è @Ž<£Ø’@”Çà‘è ã¿ #F’ büÿýÙ”€2€ÄbüÇà‘è €  €„ €À$ Ä$ Çà‘è ã¿ ÄN`€  € !FÄ#x€  "€8À$#x@ŽBÐ#x€4À$#x@䀀ß@Ž G’Ô <G– h@Žg˜Çà‘è %FÄ£x€  €¢ @Ž+Уx¢@Ž(„@’ @*ÌУxÐ$£xÄ£x€@ŽC’@ŽÆ£x„@ˆ ’ È(À† „ È£xÒ)ˆ Æ£xÈ(ÀÇà‘è ã¿ ’!Gÿý…” ˆ€ Ä €  €F„ Ä ãüÇà‘è㿘’ÿýt”¿ü€2€Ä¿üÇà‘è €  €F† ˆ£Æ!?èÄ£€  €„?ÿÆ!?üÆ! äÄ!?øÀ! üÇà‘è ã¿ @ F€€ß@© @G’Ô <G– h@Ž˜Çà‘è #FÄcœ€  €@ÂÐcœ@*„Ð$cœÇà‘è ã¿ #F’ bèÿý5”€2€ÄbèÇà‘è €  €Ä €  €„ Ä$ Çà‘è ã¿ ÄN`€  € @º’ €€ ß@*^FÐ £ðÇà‘è ß@i hG’Ô <G– h@Á˜Çà‘è ’–ÐJ ” €¢ "€ÐJ`ÐJ`јaì ÿ‘* Ð €Š "€ÐJ`‘*  •* ÐJ`’`" 0”€ÐJ`€¢ € ÐJ` ÿ‘* Ð €Š ¿ÿñ‘* ÐJ`€¢ €€¢À "€”?ÿ€”?ÿÃà ã¿ ÄN €  "€ ÄJ ÄN €  :"€ÄJ ÄN цaì„ ÿ…( Ä€€ˆ @2€ÄJ  ÄJ €  € ÄJ €  :€ ÄJ „ ÿ…( Ä€€ˆ @"¿ÿó ÄJ €  :€ €¢€ @L’ €"€„ Çà‘è „ Çà‘èFÐcT€¢ €‚ÐcT@TžÃàã¿ …. :„€†`0…( „ €…(  €Ä „€  "€À$ ˆ@Ð „À$ „À$ ˆÇàèã¿ ¨¦@€{/:¤Äà, à,€  €%-5Ģ̀ ¿ÿ€À%¢Ì€Ä¢ÌÿÿÛТÌĢ̇( €¥ €†À‡(à„ À† …( €  €@)ç’Ð$ „Ä „Ä$ ˆ€JÄL¿ÿ’@Œ²”À,à$ ˆ€BÄL¿ÿĢ̇( †À‡(à„ À† …( ¦€Äà„€  €@ŒÓÐà„ª Ðà„@)v’`Ð$à„’Äà„€@Œ•”Æà„„ Ä(ÀÄà„Ä$àˆ€"ÄL¿ÿ@Œ¿ €¤ €€ª@)V Ð$à„’Ðà„@Œ”Äà„’€@Œ|”Æà„„ Ä(ÀÄà„Ä$àˆ€ ÄL¿ÿÀ’@Œq”À,Àæ$àˆÄL¿ÿ† €   2€† Æ%à,Äà,€  €Ä¢Ì„ Ä%¢Ì€  6€À%¢ÌÇàèã¿ ÄN €  € @ŒŸ’ „€¢ @Œ‚¢€ ÿÿn’ÄL`€  ¿ÿðÇàè=Ð!X€¢ €=Ãà Ða\€¢ €GÃàÐa\Ãà`hã¿ @Æÿÿꆀ8€¦ € €¦ €F€¦ "€F€€ F€Ä¢Ô€  €&€ĢЀ  € FÄ¢Ô€  €€ĢЀ  €@Œj’=Ä¡T€  €5ÿÿŸ5ĢȀ  €„ @Pè=Ä áPÇàèã¿ ¦¿€¢ÿÿª¨ €= Ä¡T€  €’@Œ´”€-5Ä ª€  €”æ è ’@Œª–€¢?ÿ€ £- Ð @(ª’Ð$ â$ Çà‘è €¢€ ¢ Ð @( ’Ð$ â$ Çà‘è ÿÿd@Œ%’Ä €  €5@‹æÐ 5ĢȀ  €„ @ €=Ä áPÇà‘è ã¿ ÿÿb„€„ @Œ„ =Ä áPÇàèã¿ !5Ä"È€¦€€¦ €=À$"ÈÇàèÄ¡P€  €„ ÿÿã„ Ä$"ÈÇàè=’СTÃàÒ"¡Tã¿ô' Lö' Pø' T@ú' X=Ä¡X€  €1€¦ € €¦ €F€¦ "€F€¿ô€ F€¿ôÄ¢Ô€  €€¿ôĢЀ  €FÄ¢Ô€  €€¿ôĢЀ  € ¿ô’ @‹b” ¿ô’ÿÿY” L€¿ÿü¿ôÇàèã¿ò' HFô' Lö' Pø' Tú' XÄ£à€  €@Î=Ä¡X€  € ¿ô’ @‹C” ¿ô’ÿÿ:” H€¿ÿü¿ôÇàèã¿ †€€€8„aˆ€8„aŒ@‹q’=Ð ¡\Ä¡\€  €€FG=„`hÄ á\@‹xÐá\@‹Ü€€=„ Ä áTÇàè@‹ÕУ@Šï‘è ã¿ !=Ä!\¢!\€  €¤ @‹RÐ!\À$!\„   Ä$üä$øÿýú  €¤ ¿ÿý5„?ÿÄ âÌä$rÐÇàèã¿ +5æbÌÿþ™ ¢€<€¤ÿÿ€:):Ä ,¤ ,€  "€¦  à€¤ 6€  ¦ …, „€…( „ €…( †€Äàˆ€  €  Ðàˆ@‹&’€¤ 6€  ÄbÌ€¤¿ÿï…, Ä ,€  €Äb̈ Œ‡( †À‡(à„ À…( Ä€€  € Äḃ( †À‡(à„ À…( Ѐ@‹’@‹‘èÇàèã¿ ß@) ¢ß@Š˜ œ:’Ô (G¤ h@Šð–ß’ È@Šã=Ð ¡\Ä¡\€  €ß@Š„ Ì G@ŠÐ¡ˆ’–@ŠÛ”„ =€Ä áXÿÿ“@Š=„ Ä áTÇàè5ÐbЀ¢ € Ð"bЂÿÿÇžÃà5’ТЀ¢ € :=Ð!T€¢ €: Ð"¢Ð:ÃàÒ" (ã¿ ß’ è@‹& ß’ ì@‹" ß ðß@‹ ’ øß@‹ ‘è¡ã¿ ß@Š>¡G°ò <@‹èßã¿ @Š5¡87@ŠûÒ pÿÿðß@Š-¡lG  X@ŠŒ’ß@Š&¡¸@Š‡’ß@Š!¢¬@Š‚’à@Š¡˜@Š}’á@Š¡è@Šx’á@Š£D@Šs’â@Š £(@Šn’ã@Š H@Ši’ã@Š¢`@Šd’ä@‰þ¡ø°@Š^“è„ Øø4Plx”Ô° ØÌ Ø< ¬ ä t 8 p€ Ø ¨ Ä Ø Ø Ø Ø Ø Ø Ø$@\ˆ Øðh ( Øè D ` ÈX¬È T Øä Œ Ø Ø Ø Ø Ø Ø Ø Ø8Td€pŒœ¸Ôð¨ (ÄàD`|˜´ Øü4 ØÐìÜ Ø ØPlˆ¤Àã¾øÿÿ<¢Ð`)G¤@Š?’ /Ð% <  Ä <€  2€Ä <Ä`€Ä% <„ Ä% <ÿ÷õ9”¡`5ª¢Ô’–ÿÙ{˜ €¢?ÿ€v†9®¡¤ ¬¡Üˆ„ à?€  f€d”…( Ä€À€ä¢4äÿø´’¢<€Y”ä¢@äÿø­’¢L€R”ä¢Päÿø¦’¢\€K”ä¢`äÿøŸ’¢p€D”ä¢täÿø˜’¢„€=”䢈äÿø‘’¢”€6”䢘äÿøŠ’¢¤€/”䢨äÿøƒ’¢´€(”4Ò Ìäÿø|¢¸€!”ä¢Àäÿøu’¢È€”ä¢Ìäÿøn’¢Ø€”ä¢Üäÿøg’¢è€ ”ä¢ìäÿø`’¢ü€”4Ò ÌäÿøY£€þ”ä£ äÿøR’£€÷”ä£ äÿøK’£,€ð”ä£0äÿøD’£<€é”ä£@äÿø=’£L€â”ä£Päÿø6’£X€Û”ä£\äÿø/’£l€Ô”ä£päÿø(’£|€Í”䣀äÿø!’£Œ€Æ”ä£äÿø’£ €¿”䣤äÿø’£´€¸”䣸äÿø ’£È€±”ä£Ìäÿø’£Ô€ª”ä£Øäÿ÷þ’£è€£”ä£ìäÿ÷÷’£ü€œ”å åÿ÷ð’ €•”å åÿ÷é’  €Ž”å $åÿ÷â’ ,€‡”å 0åÿ÷Û’ <€€”å¡Øåÿ÷Ô’¡à€y”å¡äåÿ÷Í’¡ð€r”4Ò Ìåÿ÷Æ¡ô€k”4Ò Ìåÿ÷¿¢€d”4Ò Ìåÿ÷¸¢ €]”4Ò Ìåÿ÷±¢€V”4Ò Ìåÿ÷ª¢ €O”4Ò Ìåÿ÷£¢(€H”4Ò Ìåÿ÷œ¢8€A”4Ò Ìåÿ÷•¢D€:”4Ò Ìåÿ÷Ž¢P€3”4Ò Ìåÿ÷‡¢X€,”4Ò Ìåÿ÷€¢d€%”4Ò Ìåÿ÷y¢p€”4Ò Ìåÿ÷r¢x€”4Ò Ìåÿ÷k¢„€”4Ò Ìåÿ÷d¢€ ”4Ò Ìåÿ÷]¢œ€”4Ò Ìåÿ÷V¢¨€û”4Ò Ìåÿ÷O¢°€ô”4  Ò Ìåÿ÷G¢¸€ì”4Ò Ìåÿ÷@¢À€å”4Ò Ìåÿ÷9¢È€Þ”4Ò Ìåÿ÷2¢Ð€×”'4’¿üÐàÌÿöu”¿ø€€˜Ð¿üÿ÷&Ò¿ø€€Ð¿ü@‡ô@‡òпø€Ä”4Ò Ìåÿ÷¢ô€½”4Ò Ìåÿ÷£€¶”4Ò Ìåÿ÷ £€¯”4Ò Ìåÿ÷£€¨”4Ò Ìåÿöü£$€¡”4æ ÌÄLà€  €›”ÄLà€  p€€  d€ €  H"€倠 c"€%å€cå"€倠 k"€0å€\å"€&倠 r"€倠 v€Så£0åÿöÒ’£8€%¦à£<åÿöÌ’£H€¦à£LåÿöÆ’£X€¦à£\åÿöÀ’£h€¦à£låÿöº’£|€ ¦à£€åÿö´’£Œ€¦à£åÿö®’£ ¦àÄLà€  2¿ÿ¸ÄLà€N”4Ò Ìåÿö¢£ì€G”4Ò Ìåÿö›£ü€@”4Ò Ìæÿö” €9”4Ò Ìæÿö €2”4Ò Ìæÿö† €+”4Ò Ìæÿö  €$”4Ò Ìæÿöx (€”4Ò Ìæÿöq 0€”4Ò Ìæÿöj <€”4Ò Ìæÿöc D€”4Ò Ìæÿö\ X”–’ÿט †€¢?ÿ¿ý“ˆFÄâø€  €G„?ÿÄ âøGÄ €  €-FFÄ"耠 € -Fˆ È""è†"èÀ àÄà€  "€È à-FĢЀ ¿ÿ2€ ĢІ FÄ¢Ô€  "€† Æ%¢ÐĢЀ  €FFÄ¢Ô€  €ÃæFģ䀠 €+4FÄ£ €  €Ãæ+4Ä`Ц¤@€FFÄ£€  €ÃæFĢ܀  "€Ä¢Ð@$pĢЀ  €¬ F@aУœ„à€¤à…(   ?øœ#€ `¨$€ª Ä`Ю…( @ Ѐ„"€Ä`ÐÐ%à€®à…( @#ЀÐ%à®àÄ`Ь €¥€„ Ä%`Ð&¿ÿíÄ`Ъ …- ê%FУÿû]’FÄ£à€  € %F7Ò pæ¡89ÿû2”¡èÄ£L€  €3 Ä£LÄH €  -€  £LÄ£LÄH €  €G„`XÄ$ €% Ä €  €9„aô€Ð£LУL9„aø@†°’Ð$ Ä €  €pÐ @†½@‡0’¿p€€  Ä¿„<„€ € €€ „ Ä$  @‡$’ €¢ €¥’¢H@‡ ¥’¢H@‡  @‡’ ¬’¡¼@‡ Ä €  €Q¤ "æ5FÀ'¿l®¡dæ °¡”¬¢è3GÄ¢èê'¿h€  "€ Ð @«Ð €¢ "€Ð @öÐ ¤€ Ä¡,’¿l”¿h˜¿d@z– Ä¡,¤€  "€ Ä¿h@$Gпl€"€Ä¿hÄ ø€  €ÿú¹@…üÔ¿l’ÿúw @†qпl€"€ Ä¿h@†Ðaˆæ”’¡¤ÿúk Ä¿h€  "€Ä¿l@†Ä¿l€  €  @† Ä €  2¿ÿ¼À'¿l!FÄ#€  €FÐ#FÒ£@É”¿`Ä¿`¤€  € Fæ@…Ê¡°Ô#’ÿúE FĢ耠 €€¤à€FÄ#€  €5GFУȆ£ÈÒà€’@€.GFģЀ  €9ª¡ü€ æFУȆ£È@'èÒàªæ@…£¡È @# F”’ Ø£Ôÿú–@7€€Gæ@…‘¡ü F@'•Ð£À’”ÿú GÄà,€  €FÿµÐà,FÄ£ø€  € GÄ €  €@ fÿúx€¤à€ Ð   @…—¨   €¤&¿ÿüÐ ÿøj„ €¤ ""€„ Çà‘èÿû(@…N ¿þY”7Ò på@† @å@…S T’å@† På@…L ¬’å@† ¨å@…E¡˜@† @…2 ¿þ=”@…. ¿ýqпüå@…8¢ØÔ <’GÖàÌ@…’ h@…! ¿ýdпüå@…+£¤Ò <@…ñÔLàÿúæå@…ì£Äå@… £È@…çÒ <@…  ¿ýƦàÿúØæ@…Þ dæ@… h@…ÙÒ <@„ÿ ¿þ ”@…  Œ@…ÑÿúÆ@„õ ¿þ8F@… ¼@…Çÿú¼@„ë ¿þ8+4@„ö ü@…½Ò <ÿú²æ@…¸¡æ@„ì¡@…³Ò <@„Ù ¿þ0F@…¹Ð£L@„Ó ¿þÐ ã¿ €¦ €9€ „b€¦ €9€„b9„bÿúp@¸¥@…°“è¢HÃà X‚@…¦ž–˜  ’ ” ‚@…¡ž” ’ ‚@…žžã¿FÄ£d€  €…!=¤Ä!`¦€  €))Gÿò_+G„ Ä%aŒ¨„ Ä$!`"€ )G@„Æ æ@„¢$„  æ ?ø’¢,œ#€9 `–¢  @„ï”@„±’¿x@„ü€€)G@’Ð%aŒ)GÄ!Œ€  €SÄ`€  "€à!ŒÄ €  €Kà!Œ€¤ €€¤ Ä €  "€ à Ð @„¥’€€€¤ à €¤ 2¿ÿõÄ €¤ €€¤àÄ`€  "€ Ä Ð @„RÒ`€2€,À$ Ä Ä$ ÇàèÄ&`Ä €  €#Ä Ä$ Çàè€Ä`€  €Æ!Œ€ à€ € àÄà€  €€ àÆà € à2¿ÿûÄà€ à€ ÄàÄ&`Ä €  €ÄàÄ$ Çàèã¿ ä ¢ æ`€¤ €€¤ Ä €  € €¤ @„BР@„@Р@„>Р€ €æ$  ¦@ Ö ¤’ @„” ä$ æ$`Çàè’ÐJ €¢ € ÐJ`Ð*`’`ÐJ`€¢ 2¿ÿüÐJ`Ãศ Œ4Xã¿æ¨ À'¿øè'¿ü’¢4@„>„€Ð# \æ@ƒá¢8 G@ƒìСˆG’Ô <G˜ h@„5–Ä¿øÇà‘è@#õª ¬ „€+æÐ# `º¢TG² h¦®¡ô9†¢0Ñ´ÿø¢¡ì¶à¸à ¬ Ä `¤  ÄH €  €€¥ ÄL „ ÿ…( Ä€€ˆ @€€¥   ÄL €  € €¥ ÄL „ ÿ…( Ä€€ˆ @2¿ÿ÷  €¥ 2€ÄL ÄL €  "€¨ ÄL €  €ï€¥ €ìÄL €  "€ÄL ÄL „ ÿ…( Ä€€ˆ @€  ÄL €  € ÄL „ ÿ…( Ä€€ˆ @2¿ÿ÷  ÄL €  #€ÑÄL €  €ÍÄL €  "€¦ÿÿo¤ ÄL €  €*€¤ "€ÄL ÄL €  "2€ ÄL €"€¤ „ ÿ…( Ä€€ˆ @€€¤ ÄL €  \2€  ÿÿV  ÄL €  €€¤ "€ÄL ÄL €  "2¿ÿòÄL € €¤ „ ÿ…( Ä€€ˆ @"¿ÿêÄL €¤ "€ÄL ÿÿ>ÄL €  €†À,   €¥ €2€¥`…- Ä€À€Ä¿ü€  "€)ª@ Ä¿üÐ  €$€¥`¿üÿÿ’¿ø@ Ä¿üÐ  €€¥`Ä¿ü€  €9@ Ä¿üÐ  €€¥`ªb0€€¥`Ä¿ü€  € €¥`ª€€¥`Ä¿ü€  "€ª€¥`€€¥ @ƒ’G–Ô <˜@ƒZšª €¥ €æ¨ €EÄL ’¢”@‚í€€æ¨ €<ÄL ’¢œ@‚䀀¿üÿþ¾’¿ø€2ÄL æ’¢¤@‚Ù€€æ¨ €(ÄL ’¢¬@‚Ѐ€æ¨ €ÄL ’¢´@‚Ç€€æ¨ €ÄL ’¢¼@‚¾€€æ¨ € ÄL @‚¹¢È’GÔ <–˜@ƒšÄL €  €€¥ 2¿ÿÄL @‚ÓР`@"ÌР\Ð# `„¿þ謠@‚þР\¿üÿþz’¿ø@‚ÆпüÄ¿øÄ'¿ü€  € À'¿øÄ¿üÆ  È¿ø€ àÈ   Ä¿üÆ'¿üÄ'¿ø2¿ÿùÄ¿üÄ¿øÇà‘èã¿  €â Ä €  "€Ä @‚©Ð Ä €  "€Ä @‚£Ð Ä €  €@‚Ð @‚› €¤`2¿ÿêâ Çàèã¿ 6¢£Ô@‚©’ :„€¤"€  @‚Š¤  Ð`’@‚Ÿ”€€  ¢`€¤ *¿ÿøÐ`Çà‘è Çà‘è ã¿ 6 ¢£Ô€æ ¢è@‚†’ :ª€¦¨"€¤ @‚f¨¤ Ð`’@‚{”€€¤ ¢`€¤ *¿ÿøÐ`@‚fè==â ¡l„ €¥`Ä áh2€¦`Ä`€  €à`Ä‘èÇàè =ÃàÐ"adã¿ '=Äád ád€  "€ Ä Ä €  2€À$ádæÿÿ½¢ìÀ$ádÄ à Äèã¿ =Ð!lÐ Âèã¿ =Ð!lÐ Âèã¿ @¹ ¨’ @ý”  à% ¢â% Ä €  €N5G¬  ê¿üпü@‚mÒ  ®Ð @‚É’Ä °¢¦ €…<à„£ÿ„À³8  €æ@$¤€¢ €æ¤ @Æ¢ð9’–¢T”  ÿö>˜æ ’£ÿö9”€¦€æÒ ¤£æ°£@‚¡Ð €€’’ÿõx ’¢$@ÿõt Ä €¤@„ Ä% 6¿ÿðÒ Ä  Æ € À€ æâ% @‚‹’Ð% Çà‘è£æ’£4@‡” ö¿ÿõâ% @Yœ¿˜¨Ð# dæ‚Ò# `’#@ ţɠd‰ …¡ BÉ `‰ … ‰Ä… BÅ# \Ô \œ hÿõöžã¿ Ä ’&€@ b” æ”’£Hÿõë ô& Çàèã¿  5G¨  ¢æ?ü¬ Ð?ü@ïÒ  ªÿõÀ Ä „€Ä& Ä € €€Næ²£Xæ°£T殣LÄ`€  2€ Ò Ð` @Ø’…: ’„£ÿ„•8  ÿõÀ Ò @‚.Ð`€€’’ÿõ ’ÿõ Ä`„ Ä$`Ä  Æ`€ À&€ Ä`Ð`¤@‚’Ä` € €2€Ä` Ð`@‚’Ä` ¤%@„ Ä$` ì$`Ä`€  €Ð` @¦’ÿÿŠÒ`’ÿÿ›”Ä`„ €Ä$`Ä`€ €6¿ÿ½Ä`ÿõk‘è ã¿ ¢1G¨ æ?üÐ?ü@Ò ªÿõ` Ä`€  2€à`Ð` @…’…: „£ÿ„•8  æ’£\ÿõl à`Ä €¤6€Ä`Ò 殣h欣d@Ñ€€’’ÿô¨ ’  ÿô¤ Ä €¤&¿ÿòÒ Ä`€  "€Ð`Ð` @\’ Ð`@X’Æ`„€ÿÿ9Ò`Ð`@P’Ä`¦Ð`@®’Ä`  € €€Ð`@£’ $À’ÿÿ9”æ’£lÿôw ÿõ  @€Ð‘èã¿  €GÄN €  €€¤ Gà €¤ €Iæ’£p@€Õ€€ „$Gˆà Ä!?ü„ Ä! „ 2Ä à Çàèæ’£x@€Å€€ Gˆà Ä!?ü„ Ä! „ 0Ä à Çàèæ’£€@€µ€€ @Gˆà Ä!?ü„ Ä! „ 0Ä à Çàèæ’£ˆ@€¥€€ Gˆà Ä!?ü„ Ä! „ Ä à Çàèæ@€W£G²° h@€²•èÇàèã¿ @ ¤’ @€W”  ¢€¤€6¢à$ â$ Ä£ü„  Ä$ Ä @ æÐ$ ’£Ìÿóÿ @_’ @ßРÇà‘èã¿ Ä ˆ „€Ä& Ä €  €6Ä Æ „€Æ € €€6Ä 6Æ „€Ä& Ä#üÆ „  € €"€ Ä Ä#ü„  Ä& Ä ’ @ÞÐ ˆ Ð& Ä „&€€  È€€¡ 2€ô& Çàèô& @*’ð @©èã¿ Ä ˆ€  €€¦`Ä Æ „€Æ € €€€¦`Ä Æ €¦`„€Ä& €ˆ @’@Ð æ’£Ðÿó§ @€Ð @€è@Y@@ã¿ä Ä Æ ¨€@!Ó@ö„ €¢ 6€„Æ „ ¦ À€¤à&€¦ Ä €  € ªè# `Å¢pÉ `‰ …¡ BÉ ‰ … ‰Ä… BÅ# \ê \€¥`d€D€¥`d€ æ’£ô¤ @€ ”€€¤àæ’£ü@ñ¤ € €¤àç’ ¤ @‘” €¤à€:€¤àÄ €  €6€¤àè# dÉ æ# `‰ Å d… … ‰ÄÉ `‰ … ‰D… BÅ# \ê \€¥@€„ [† Ä, €¥`’€„ À €¥`€ „ > =Ð(àˆ%`„†àˆ! €  4¿ÿüÐ(à„ >Ä(à†à„ À € €6€ „ ]ˆ È(à„ †à€ €&¿ÿýÈ(à„ ]Ä(à€<¤à€:…,à’  @€FÐ „$à€¢€ˆ €„ [„"„ ˆ$À„ [Ä, † €¤à€"„ ]š! „  <’ ” >– =˜ € € €€ €Ð(à†à€„ €€ € Ö(à†à€ „ 2€Ò(àÔ(à†à€„ †à„ € €¿ÿ뀠€ „ ]Ä(à¤àÄ „ Ä& @!(ç”’ 0@@F€¦`€¤€Ä €  €çÀ'¿ü”¿üÐ @ #’Ä¿ü7†`…( Ø€çÁ# `’ 8Ã# \Ô `@fÖ \@+¤€€ Ä ç’ D¤  @~ï” Ä €  $€gÄ Ä €  $€cÄ ò# dªÅ¢xÄ É d„ €Ä# `‰ $h¬…¡ ÂÉ `‰ … ‰DÉ ‰ … ‰Ä… BÅ# \à \@g’£Å„ ‡< …8  ¦ €…,à„ €…( „À…(  $"""@Y’ ‰„ €¤à‡< …8 ¨ €…- „ €…( €  $€¤àc€ €¤à €ç„ Ä, ¤ € çç’ P¤ @~©” ç’ T@~¤” €¤àc€¤ ç’ \@ €€¤à€ ç”’ d–@~þ˜€ç”’ t@~÷–@~¼¤€€ Ä €  $€ Ä ¤  ç’ €@~}” Ä Æ „$€€ €€$çÄ Æ „€€¤€:€ À, ˆ È, Ä ¤ Æ „€€¤€*¿ÿûÈ, À, Çàèæ£Ôæ’£è@~\”"<¿þ¸€¥`dç  ç’ $@~T”"N¿þÝ„ [ ç’ ¬@~M”"µ¿ÿÚÄ ã¿ ÿòÇ ç °’ ¸ÿò  ÿò’ÿò¼èã¿ ç@~ã ¼¢€¦ € Fç’ Ä@~3€€F=„ Ä áhFÄ£€  €G@~• h@~ù€€ =€¤`€ç’ Ì@~€€ =Ä¡h€  €çÿûÉ‘è Ô@$f†€€¢ -€6Ð £üÇàèã¿ @$U†€¬€¢ -€¬6Ð £ü¬²¡¼@~Ø‘è Ò" ’ ”àÒ" ’ ”àÃàÒ" Ð ?ÿ€ Ãà@ ’?ÿÃàÒ" ’‚Ð ’`ÿ¤Yžã¿ ' ¤àÄ€  €¢† „àÆ$”À$Ð ÿ¤I’„4€Ð$€„àÄÄH Ä,`„ Çà‘èã¿ '¤àÄ€  €¢Çà‘è Ä€ €€€¦`â"€Ä„àÒ@}¥”Ä„ €Ä&„àƆÀÆ&Çà‘è’ ”àÒ" ’ ”àÃàÒ" ã¿ @] °’ @}¡” Çàè‚@}°žã¿ @I ò" ¨ô" ö" À" Ä „ Ä& Ä Æ € À€!FÄ Ä& Ä#à€  "€Ä#à’ç Øÿò"”Ä#à€  "€Ä Ò ç ôÿòÔ Ä €  "€è& Ä è   è& Ä €  €Ä Ä& Çàèã¿ â €¤`2€Ä Çà‘è Ä  Ä& Ä €  €%FÀ& Ä`Ä&`Ä`Ä& Ä`Ä&àÄ „  Ä& Ä£à€  "€Ä£àÒ`ç¡ÿñêÔ`Ä£à€  €çÒ ¡0ÿñáÔ @}NÇà‘è ã¿p’¿üª "@¬€ @пüç–’¡P ÿñ‘”Çà‘è ÿÿz®¨ ÿκ °@õР” ’ÿÿ‚– Ò @‚9²¢h9´¢xÀ'¿ø@ ˜¦ €€€¥`€’¿ô”¿ð–¿ìÿÿ¢€€!=Ä!x€  "€"À'¿èÐ!xÿÍ{Ò¿ô€"€À'¿èÐ!xÿÍUÒ¿ô@ËFÐ'¿øÄ£à€  €=甡\ÿñÒ¿ô=Сp@gÒ¿ø€€7€¥ ¨ €4€¥ !Fè'¿ä’¿øâ"蔿äè$"èпôÖ¿ð@ *˜¿èâ$"èªÄ¿ø€  "€ Ŀ䀢 "2€ Ä¿äĿ耈 "€Ä¿ä€ˆ 2€¨ Ŀ䀠 €€¥ €Ò¿ô–Ô¿ì@˜€2€Ò¿ô€¨ @@|ÃпôĿ䀥 Ä'¿ô€'€¥ FÆ¿ìÄ"ø€ À€!€¥ Ä"ø€ ¿ÿ€€¥ GÄ €  €FÄ"ø€ À"€¦ Ä"ø„ € À€F¦ € €¥ Ä£à€  €¨ çÔ"ø¡Œÿñ+’€¥ €L!GпøÒ¿ôÀ'¿àÿÙ'”¿àF¨Ä£¸€  € €¥ Ä¿à€  €€¥ @¨ €¥ €8!G¢Ð¿ô@L’ ¶€¥çÄ `…0 €ˆ 2€$â`€¤à"€Ô¿ìÄ `…0 €ˆ "€â`Ô¿ì’–@™˜€"€â`Ä`@'Р @$пôÄ¿ì’”– ÿþ°Ä`Ò @¯â`€¤`2¿ÿÙÄ `@@ã!GÄ €  € Ä¿ø€  €5@€€0FÄ£à€  "€ Ä Ä †€  €ç†¡ØÿðÄ’Ä €  €ç@|¢ „€Ô¿øç@{ý¢Ô¿ø„ ÿðw’@|qпø€€ G@{ÿСˆç”’¢Hÿðj @•Ð¿ø@|пôÄ¿ð€  "€Ä¿ø@| Ä¿ø€  ¿þä¨ @|¿þਠ’¿Ü”¿Ø–¿Ôÿþ‡€€Ð¿Ü@{ùÄ¿Ø€  €’¿Ü@{ó’¿Ü”¿Ø–¿Ôÿþw€2¿ÿòпÜÿþ8@´@`@ Y€€„ "Çà‘è 6€¥`"€„ Çà‘衼璡Ð@{¡”!T¿ÿYÄ `㿘ê ¢1F®#àì`Ä#à€  €ç¢TÿðU’@0’€"€ Ä`Ä#à€  "€üÄ#àçÿðH¢x€÷Ä#à€  "€Ä`Ä`€  2€Ä#àÄÿd€  2€ Ä`Ä#à€  "€èÄ#àçÿð4¢”€ãÄ#à€  €Äÿ€  €Ä `…0 €ˆ € Ä#à€  "€ÓÄ#àçÿ𢸀ÎÄ#àÿÏ®€2€ ÄÿÄ#à€  "€ÅÄ#àçÿð¢è€ÀÄ#à€  "€,ÄÿPÄàÆ`€ À2€'ÄÿPÐ`@{ˆÒà€2€!ÄÿPÄà Æ` € À2€ÄÿPÄà<€  "€Ðà Ä `…0 €ˆ 2€ÄÿPÐà @cÒ` €2€ ÄÿPÄ#à€  "€šÄ#àÒ` ç£ÿïäÔà €“Ä#à€  2€Ð` ÄÿL€  "€Ä`$Ð` @ž’ €2€ Ä`$Ä#à€  "€‚Ä#àÔ` ç£<ÿïÌ’€{Ä#àÄH €  "€*Ä`@ €ç@{’£`€€ç’£h@zû€€ Äÿ€ ¿ÿ"€Ä`Äÿ€¦€&€Ä`@×Ð`$€2€ Ä`Ä#à€  "€VÄ#àÔ`$ç£lÿï ’€OÄ#àÆ`€ À2€ÄÿØÄÿ €  2€ÄÿØÐ`@{Ò`€"€ ÄÿØÄ#à€  "€=Ä#àÒ`磔ÿï‡Ô`€6Ä#à€  "€;Ä#àÄ`€  2€7Ä#àÐ`@[Ò`  2€Ò`’¿ü@u€€ ç@"пü @zÜпü€Ð`£Ð@Ö’  Ð`Ò` @ ”Ò`@Ï€2€Ä#àÄ#à€  €ç£ÔÿïU’@’Ä#à€  "€„ èÿïK  Çà‘è €  €„ èÿïC „ Çà‘èã¿ ¤@ w’ ª¦€)@ q’ ¬€, @? ’ @zƒ” ”ì$ ’–ÿþʤ@^@\@z€¤ € FÄ£à€  €è tÿï’Çà‘èè <è’ P@zF”"q¿ÿÓè Xè’ l@z>”"t¿ÿÐ ã¿ ÄN ’ ˆ€  €€¢`ÄN`€  €€¢`ÄN`ÆN € À€€¢`ˆ  ÄI €  € ’`ÄJ €  €€¢`ÄJ ÆI € À"¿ÿôˆ €¢`2€ÄI Çà‘è €  2€ÄI ÄJ €  2€ÄI Çà‘è €  "€ÄI ÄJ €  "€ÄI Çà‘è €  2€ÄJ €  /2€" ÄJ €  /€èÄJ €  €èÇà‘è @yø’ ˜€ „`?ÿÇà‘èã¿ ’¢@yï €€ =СxÿË’@z@zÇà‘è ã¿ =´ð!x°ÿËG“ê!ì㿘)=Ä!|¦!|€  2€ÄÿüÿË„ Ð%!|Äÿü€  2€Ð!|ÿË} Ð$ÿüÐ!|”¿ü–¿øÿÊG’€€Ò¿ø@y¿€€8Ò¿øÿÿy€"€ Ð!|ÐÿüÿÊL’€"€ÐÿüÐ!|ÿÊÈ’@yØпü@yÖпøÿÿÈ@– @“”’ÿÊ„Ð!|Ðÿü”¿ø–¿üÿÊ’€€ ÐÿüÿÊ®’@y¾Ð¿ø@y¼Ð¿ü@~ @{”’ÿÊlÐÿüÇàèã¿ '= Äá|¤á|¢€  2€Ä¿üÿË, Ð$á|Ä¿ü€  2€Ð¿üÿË% Ð$¿üпüÿÉç’¢€èпüÿÊ’€€ @T²@Qð¿ü´ÿÊBèÇà蠤蒠´@yO”#=¿ÿëпü㿘%=Ä¡|¢¡|€  2€ÄüÿÊý Ð$¡|Äü€  2€Ð¡|ÿÊö Ð$üС|”¿ü–¿øÿÉÀ’€€ С|ÿÊR’@ybпü@y`пøÿÿRÇàèã¿ %=Ä¡p€  €¢¡pÿÊÚ Ð$¡p€ СpСpÿɺ’€€ Сp@¡’Ð`@f’Ð$`Çàè@@㿘@±¬ ®!=@`Ð!t²!tÐ$!tð!t€¦ €]¤ ê ¦ ¨ 9FÐ`ÿÉs’ 2€ Ä#àÄ#à€  "€Kð è ¼ÿí­’€Eð €  €è’ àÿí£”’ÿÕ£” ´€/ â Ä …0 €ˆ "€Ð`ä$ €#à ÿÉLÒ`¶"€Ä @¿è$ Ð$ Ä#à€  "€à èÒ` øÿí‚”€à …0 €ˆ "€æ$ À$ Ä#à€  "€à è¡ÿísÒ`à €¤ 2¿ÿÖâ ¬ @q’@ m𠀦 2¿ÿ¬ê @b ° @Qè@x¡¡@à# d±²Å¡hÉ d‰ …¡ ÂÅ# `Ç# \ö `ø \ÿí•èã¿ #=Äa| a|€  "€Ä?ü@CÐa|ÿÈÔÐa|À$a|Ä?ü€  "€Ä?ô@:Ð?üÿÈËÐ?üÀ$?üÄ?ô€  €@Ð?ô@ëÐ?øÀ$?øÇàèã¿  €¦`€ ¢ÄN €  *€„„ Ä$ À$`Çàè„„ €€  € è’¡h@x“” €€„ Ä$ Ä$`ÇàèÀ$ À$`Çàèã¿ †€¦@€ÄN`€  /"€†`@l’Ä ¦„ Ä& Ä Æ € À$€Ä Ä €  €„ Ä& €Ä Ä …( Ä& Ä ‡( „ À“( @Ð Ð& Ä ‡( „ ÀÆ …( „Àæ ¿ôö ¿øø ¿üÇàèã¿ Ä ¢ €  €…,`Ä † ˆ „€Ä €  €ˆ ¢`Ä †à€ À&¿ÿ÷Ä …,`„ €@Ó‘( Ä ” ¤€  €€¢€Ä  ˆ ’„€Ä €  €  Ä ” †€ÄÄ"`ÄàÄ"`ÄàÄ"`’` ˆ Ä €¢&¿ÿîÄ €¢€€ èÐ @xä& â& â& Çàè¡pè’¡|@wÒ” ®¿ÿôÐ 㿘 ¢À'¿ü°² À'¿ø@š ´’ @wÞ” €¤® ª €€¦`Ñ”&¶¡ì躡踡„¨@x’ †2€¨ €¤@€€¤@ÄL`„ ÿ…( Ä€€ˆ @€€¤@¢`€¤@€ €¤@ÄL`„ ÿ…( Ä€€ˆ @2¿ÿø¢`€¤@:€ê¢ÄL`€  #"€æ¢¤€¤@"€ ÄL ÄL¿ÿ„ ÿ…( Ä€€ˆ @"€¤ ÄL €  #€€¤€¤ €¤€ ¿ÿñ€¤€€€¤@ÄL¿ÿ„ ÿ…( Ä€€ˆ @€€¤@¤$ €¤€€ €¤@ÄL¿ÿ„ ÿ…( Ä€€ˆ @2¿ÿø¤$ €¤@€Ö¬€¤@€†ÄL`„ ÿ…( Ä€€ˆ Œ2€¢`ÄL`€  -€†¢`€¤@€†ÄL`„ ÿ…( Ä€€ˆ Œ2¿ÿø¢`ÄL`€  -"¿ÿô¢`†€¤@€€¥€ÄL`„ ÿ…( Ä€€ˆ @€€¥€¢`€¤@€ €¥€ÄL`„ ÿ…( Ä€€ˆ @2¿ÿø¢`€¥€€|€¤@€{FÄL`€  :€v¦`€¤À€€¤ÀÄL`„ ÿ…( Ä€€ˆ @€€¤À¦à€¤À€ €¤ÀÄLà„ ÿ…( Ä€€ˆ @2¿ÿø¦à€¤À€¢¦à€¤À*¿ÿÿ¦à¤ À€¤  €è’¡´@wI” €€€¥`€Ä¿ü€  2€Ä¿ø”¿ü–¿ø’$Àÿþ”Ä¿ø€  "€Jª ² ª €G¢€¤ €è’¡À@w-” €€Ä¿ü€  "€9ª`’Ø¿ø”ª`ÿþš– €1¢€¤ €è’¡È@w” €€Ä¿ü€  "€#ª`„ €¤@€Ø¿ø„ ’”ÿþ–ª`€¢FÄ£à€  €¢è¡Ôÿ뀒€ ¢FÄ£à€  €¢衘ÿëu’¢®à€¥¿þ÷”&€¦`"€Ä ÿþ‘Çà‘èÆ € À€ Ä ‡( „ À“( @yРÐ& Ä Ä& Çà‘è’@v’”!¿ÿ(¬ã¿ @좀 G@vœÐ¡ˆè–’¡ø ÿë”Çà‘è Ð ÿþ«Ò` @OÇà‘èã¿ Ä €  $€Ä Ä ¢ ¤ @vЀÄ ¢`¤  €¤@&¿ÿúÄ Ä €  €@v‘Ð @vèã¿ ÒN ÔN`€¢`"€‡„ Òˆš ìÑž¡ì€¢ €}€¢`%€8€¢ %ÄJ „ ÿ…( Ä€€ˆ¡€1€¢ %ÄJ „ ÿ…( Ä€€ˆ¡€*€¢ %ÄJ €  0&€ ÄJ ÄJ €  94€ÄJ ÄJ –  0€ÄJ „ ÿÄ€ –  7ÄJ €  0&€ ÄJ ÄJ €  94€ÄJ ÄJ ˜  0€…*à„ ÿÄ€ ˜  7…*à„€ …( …8 €  /€€¢ %’ €¢ %€8€¢@ ÄI „ ÿ…( Ä€€ˆ¡€1€¢@ ÄI „ ÿ…( Ä€€ˆ¡€*€¢@ ÄI €  0&€ ÄI ÄI €  94€ÄI ÄI –  0€ÄI „ ÿÄ€ –  7ÄI €  0&€ ÄI ÄI €  94€ÄI ÄI ˜  0€…*à„ ÿÄ€ ˜  7…*à„€ …( …8 €  /€€¢@ ”ˆ €¢@2€ „ ÒJ ˆ ÔI  €¢`¿ÿ‡€¢ Çà‘è „ Çà‘èã¿  2€Ä Çà‘è €  €-¤ Ä ¦ Ѐÿÿg’€€ ¦à Ä ¤ €¤€&¿ÿ÷Ä €¤ …, „ €‰( Ä „€ä FÄ£à€  €€¤ €9†¢˜€Ä 9†¢¤Ä Öè’¢ ÿêa”Çà‘è¤ Çà‘è㿘@uÇ @á„’  ?øœ#€ `¨@uˆ”„ :Ä-„!= @î’Ä!€€  2€Ð!€ÿÇ\ Ð$!€Ð!€’” ÿÅû– €€’ Ð!€ÿÆX”Çàè@_’Ð!€ÿÆP”Çàè㿘@u‘ @«„’  ?øœ#€ `¦@uR”„ :Ä,À„À @¹’=Äက  2€Ðá€Çà‘è ÿÅ¿’Çà‘èã¿ è@’¢0 è@u>¢<’ÿé ’À&`” – @ ˜ ¤@u[€¤ "€ „ "Ä`€  €„ "@uRÐ`À&`„ "€ °`?ÿÇàèã¿ @uEÿþžÇà‘è ã¿ !=Ä!€€  € µÐ!€’¡PÿÆv” ÿÅUÐ!€À$!€ÇàèE’ Ò"!˜EÃàÒ"!œ@@ã¿ %E¢¡œÄü„€Ä$üÄ¡œ„€Ä$¡œÅüµÉ¡ÈF… … ‰DÉ£¼Ä¡œ‰ … ‰Ä… BÅ# \Æ \€ À$€ À$üÄ¡œ  À€¤ È€ FÄ£à€  €ôüèö¡œ°¢hÿé‘“èÄ£à€  €…, 袜ÿ鉒…, „ €…( „@u¾‘( À$üÀ$¡œÇàèã¿  ¢@Y´ F¨ö$ ¶¢Ð¸ĢЪ®€  ¤ ¬¦ ° €€§`ÿòš’´€§`€3;Äà€ €2€0Äà씢 =²¡„’ÿöऀ”’ @uQ–Ä ’”¢@„€Ä$ ÿöѤ¿ÿó€¤`"€Ä ` @tüÄ ` €ˆ  €F¤?þ€bFĢЀ  "€Äàì’ÿòx” Äà쀠 €ÿÿn@ î \€¥à€=Ä € €€G€¤¿ÿ=€¥à²¡„;€ †Ä „%€ €€’Ä †%€’’ÿšÒ”¢€0¤’ ”@u–@tÀÄ ` €ˆ  2€(¤?þ@ÿÄà즀  € F’"ÿÿA@õ¦°FĢЀ  "€Ä ’ÿò0”Ä €¥à„€Ä$ ¿ÿÈ€¥àÄ € €¿ÿÄ€¥à€€¤¿ÿ€¤¿ÿ&€¤?ÿFĢЀ  "€Ä `ÿò’Ä `€  2€æ  @ÀÇà‘èã¿’À'¿ü@!”¿ü€¦ €9ˆ¢Ì€Ä¿ü9ˆ¢ØÄ¿ü7’…( †`Ø€EÁ# ` ¡„Ã# \Ô `@t[Ö \Çà‘è@@@?P㿘 €3€¦ €9€¦`€¶@¸ ¶ð# `à# \†¢ÍÿøɢѠ`‘ ¢ FÑ \‘ ¡‰È¨ Ä9€…¡ DÀ& Çàè¨ Â€„ Ä& Íà  FÇà艠‰D¨ Ä€„   ÂÄ& Çàè  Ä„ Ä& Çàè袰è’¢¼@s¨”!¿ÿÉ€¦ è¢Äè’¢Ð@s ”!¿ÿÀ¦`ã¿ @s ’€€ÿú’Çà‘è ã¿ ´¶ÿÅ“ê#,㿬ð# \®¤ ° "€¬¿ü@zР\€¦  ¦€€¦`À& 2€À&`@y’¿ø„€¢@„пøè–’¢Ø ÿçö”@sŸÇà‘è 耥ඣX踣lFª£ô€¨ î£ôÄŒè'¿ôè'¿ð€  €„ @ ÝÐ`€€ „ Ò @ Ð`€€„ „ €€  €  "€PÄ`@ ÌÐ`¨€;è@B’¿ø €#èÄ €  € ’¿ô”¿ð–˜ÿÙ隨@2€p€¥ è@s6£$’ ÿç±”@'€¤ €@Ð@sSÇà‘è 4@s%£ @)пø’– ÿ眔€¤ €@½@s@Çà‘è 4@s¢ä’ÿæÜ @€¤ €@­@s0Çà‘è 4€  € ’¿ô”¿ð–˜ÿÙ¦š ¨€/€¥ Ä`€  €+€¥ à~ô€¤ €À%~ôÿ²t’à%~ô€¤ ¨€€¥ Æ¿ð€ à€€¥ Ä`€  €€¥ @Ü €€¥ è@s’£L€€è’£T@s€€€¥ Ä €¥ „ Ä% €wÄ¿ô€  €·Ä¿ð€  "€Ò¿ô@rëÒ¿ô@ ~ @råпôà'¿ô@®’¿ø €M@rÜпô@žÐ €¤ Ð'¿ô€° ÿÄZ ¤@*Ò`€¦ €(èÒ @:€€ èÒ @@rÃæ¿ô@¢¿ÿ,¨ @r‘£œ’Ô¿ôÿç  @‚@€€¤ €@)@r¬@rªÐ¿ôÇà‘è %@r|£€’ ÿæ÷” @m@k€¤ €@@r—@r•Ð¿ôÇà‘è %@nпøèÔ¿ô–’£tÿæà @V€¤ €@ÿ@r‚@r€Ð¿ôÇà‘èÆ¿ð€ à€€¦`Ä €ˆ €€¦`Ð`ÿøn’€¤ "€Ä Ò`ÿþªÄ €ˆ €€¦`Ð`ÿù Ò¿ð€¦`€ Æ¿ð„ € à"€ Ä&`„€Ä&`Ä¿ð€  €@rV@!€¤ €€¦ @Ê€¦ €æ& € G@rG€G2€À& @rAGÆ 0†àÆ  0Çà‘è’@r”!¹¿ÿGÄ¿ðã¿ €€ ª ’ ÿÎÁ” ¨€¦ "@#¨¦ "€¥ €hê& é3FÀ'¿ü° è¤5G¬b讣Àê'¿øÄ  …0 €ˆ 2€Sä @‡€2€T¦ 6Äb耠 "€ Ä Ä Ä €  "€Ä Ä ÿô¸Ð ¦€ Æ¿üР’¿ü”¿ø˜¿ôÿþ;– Æ¿ü¦€ à"€'Ä¿øÄ¡,€  "€#Ä¿ø@€"€Ä¿øÄ ø€  €ÿæv@q¹Ô¿ü’ÿæ4 @r.пü€"€ Ä¿ô@q½Ð¡ˆé”’ ÿæ( Ä¿ô„¿ýÄ'¿ôÄ¿ø€  "€Ä¿ü@qÊÄ¿ü€  "€ä @qÄ€ä Ä €¤ „ Ä$ 2¿ÿ¥À'¿ü@OÇà‘èã¿ €¦€é@qˆ „€° é° @q ,„ÿåK“èFңЀ¢`€’£ÐØøšøÖ`Ô`Ò`‚@’B Ò#`Ð#`Ò`Ð`€¢ €â@ € Ð £Ð?ÿÐ#`Ð#`ÃàFÐcÀ€¢ €”cÀÃà Р€¢ € Ãà Ø €  Ú ÐcÀ•: –€ã@ €ã  *€ Ãàã¿ 7Äà €  € FÀ à ÇàèÄ#´€  € #´€¦ $€ Ä?üÄ#´€¦€°& @r+èð#´@r(èÄ?ü€  € Ä?ø€  €€¦ 4€ð?üÄ?ü…( @ Ä ,¢€  € €¤`Ò?üÄ?ü”"é 8ÿåЖ€¤`€@r ‘èð?ü@rèÇàè’”ÐJ €¢ €KÒ˜ ìÑš!ìÐJ`€¢ %2€ÐJ`ÐJ`€¢ "€ÐJ`ÐJ`€¢ "€ÐJ`ÐJ` ÿ‘* Ð €Š!"€ ÐJ`ÐJ` ÿ‘* Ð €Š!2€ÐJ`ÐJ`Ð* €$’`€¢ 0&€ ÐJ`ÐJ`€¢ 94€ÐJ`ÐJ`" 0€ÖJ` ÿÐ ÖJ`" 7€¢à0&€ ÖJ`ÖJ`€¢à94€ÖJ`ÖJ`–"à0€‘* – àÿÖ À ‘* –"à7’` Ð* ’`ÐJ`” €¢ 2¿ÿ¾ÐJ`ÃàÀ* ã¿ ÄN ˆ †€  €€¡ Ò¡ìÄHà„ ÿÄ€€ˆ €†àˆ ÄHà€  2¿ÿøÄHà€¡ €„ ÀÇà‘袀@ h`ÄN ¤ˆ€  €+„!Ò†’¡ìÄHà %„ ÿÄ€ €ˆ "€ÄHàÔHà†à„  ÿ…8 €   €Ð) „ 0€Ä) „ 7Ä) „  €   6€„ 7„ 0€Ä) Ä) ˆ €ÄHàÄ) †àˆ ÄHà€  2¿ÿßÄHà„!€ €€À) Çà‘èé pé’ ˆ@p[” ÐÇà‘èã¿ ÿÿ£€¢€Çà‘è@ Bè”ÐJ €¢ %€BÑÐJ ’aì ÿ‘* Ð €Š!"€J ÐJ  ÿ‘* Ð €Š!"€C ÐJ €¢ 0&€ ÐJ ÐJ €¢ 94€ÐJ ÐJ " 0€ÒJ ’ ÿÒ ìÐ @ÒJ " 7€¢`0&€ ÒJ ÒJ €¢`94€ÒJ ÒJ ’"`0€‘* ” `ÿÒ’`ìÒ € ‘* ’"`7 ’ ÿÒ”!ìÐ @ €Š 2€ Ð @ €Š 2€ Ãà ÐJ Ò’ ÿaìÒ @€Š`"€  ÒJ ’ `ÿÐ @€Š € Ãà Ãàã¿ ÄN ¤ ¦ €  €¢ÿÿ¡„€€¢ "€¤ €¢`¦à¢`ÄL`€  ¿ÿ󀤠€€¤à€„$€Çà‘è„$€†$@…( ¨À@ £ ÄN ª¤€  €V„$€Ò¢¦ %¬ ìÿÿz„€€¢ "€ÆL`€¢ "€?ÄL`€AÄL`„àÿ¢`…8 €   €æ, „ 0€Ä, „ 7Ä, „à€   6€„ 7„ 0€Ä, Ä, ¤ €+ÄL`ÄL`€  0&€ ÄL`ÄL`€  94€ÄL`ÄL`†  0€ÄL`„ ÿÄ€†  7ÄL`€  0&€ ÄL`ÄL`€  94€ÄL`ÄL`ˆ  0€…(à„ ÿÄ€ˆ  7…(à¢`„€Ä, ¤ €ÄL`Ä, ¢`¤ ÄL`€  ¿ÿ´„$€€ €€À, Çà‘èé é’ ¨@ok”!›Çà‘èã¿ 7Äà$€  €¤ Ðà$¢à$@o•”Ò`@oš€€ ¢` Ä`¤ €  2¿ÿôÐ`€¤ …, 7„ €†`,…( Ä€€  "€¤ €¤ Çà‘è”’ÐJ Ñ–aì ÿ‘* Ð €Š Œ2€ ” ÐJ`€¢ -"€” ÐJ`€¢ +2€ÐJ ” ÐJ  ÿ‘* Ð €Š Œ2¿ÿû” ÐJ €¢ -"¿ÿ÷” ÐJ €¢ +"¿ÿó” ÐJ €¢ :"€ÐJ Ãà €¢ /€– ÐJ €¢ /"€– Ãà"À ”’ÐJ Ñ–aì ÿ‘* Ð €Š Œ2€ ” ÐJ`€¢ -"€” ÐJ`€¢ +2€ÐJ ” ÐJ  ÿ‘* Ð €Š Œ2¿ÿû” ÐJ €¢ -"¿ÿ÷” ÐJ €¢ +"¿ÿó” ÐJ  :€ Ãà`?ÿ“* 7"@“* `(ÃàÐ@“* 7"@’ •* `,ÃàÒ"€ã¿ é’ °@oÚ†€ ÄJ €  @€„"„ Çà‘èÇà‘è ã¿ ¦€ Çà‘è ’ :@o”€¢€€¢ Çà‘è "€À&à  „$¢&@¤`@ …Ð&à’¦&@Ðà@n¯”Æà„ Ä(À€ @ xàÐ& ’Р@n£”Æ „ Ä(ÀÄ €  "€Äàÿý—РÄà€  €ÿý‘ÐàÇà‘è ã¿ ÿÿy’€¤Çà‘è ÄN €  €€¤€ÄN €  :€€¤€ÄN €  /€€¤€¤ ÄL €  € €¤€ÄL €  :€€¤€ÄL €  /2¿ÿö¤ €¤€2€ÄL Çà‘è €  :€/ ÄL ш †aì„ ÿ…( Ä€€ˆ € €¢  ÄI ˆ „ ÿ…( Ä€€ˆ 2¿ÿú €¢ € ÄI €  /€ÄI €  €@nx@  é ’ ´@nª”„$€† /„Æ( Çà‘è@ni@  é ’ À@n›”Çà‘èã¿ ’@o+„€@nW„Çà‘èÒJ €¢`€– Ñ”˜cìÑšaìÒJ ’ `ÿ“*`Ò@ €Š`€"€” ÒJ – ’ `ÿÒ @ Ò* ” ÒJ €¢`2¿ÿòÒJ Ãà 㿈À'¿ü¢¦À'¿øÿþ”€¢ € Ð# `€¦`"€û„ „ Ä&`Çà‘è ÿýýÆ `7 Ð# \´ ® …(ච„ €†`$…( ° @nЀ¸ ² ¬ÿÿ騀’ Ìÿÿ¯€¥€ Ð# d€¤`"€×„ „ Ä$`Çà‘è ª ÿþâР`ÄM`€  :€2¤é `à# h’ Ôÿÿ—€¤€  €¤`"€¿„ „ Ä$`Çà‘è ¤ :€ ÄL ˆÐ hÑ’¡ìÄJ „ ÿ…( Ä€ €ˆ € …, ÆJ „€ …( €¢† à0¤€*¿ÿóÄJ € ÄL €¤`"€Ÿ„ „ Ä$`Çà‘è ÄL €  /€ † 骒 Üÿÿd º€ÄL ÄL ºª€  ;2€ ÄL † ®é’ àÿÿTÄJ  ´€  ?2€ ÄL † °é’ äÿÿHÄJ  ¶€  #2€ ÄL   @m² ÄL ¸€  €h€¥€€„%”¿ü’  –¿øÿþ’€€€¤`"€Z„ „ Ä$`Çà‘è @ ! 0 ’ @me” 0Ä `Ä$ @ tÒ dÐ$ ä$ Ä¿üÄ$ (è¿øè$ ,@ k’Ð$ @ŽÐ ’ ¢Ð @W” $ÿÿÐ €¥à¤€€¦ @ Z’Ð$ €¦ €€¦`@ S’Ð$ €¦`€€¤`@ L’Ð$ €¤`€Ä €  €€¤ €€¥@€ Ä \€ €2€Ä$ @ Ð$ € „@Ù’ Ð$ Ä \€ €"€„@m0„Çà‘èé èé’ ð@lô”#¿ÿ”€¥€ã¿  € €¦ €…. 7†`Hð€Çàèé øé’¡4@lá”#K¿ÿõ…. 㿘 ¢@m  ?øœ#€ `¦@m-’ÿûÑ@mŽ’ / € é@ À¡<Ð$`@ ½Ð& Çàè@ ï’Ð$`@ ´ Ð& Çàèã¿ Ä ¢ €  "€Ä @lèÐ Ä ¢ €  "€Ä @láÐ „ ¢@Ä €  €@lÙÐ „ ¢@Çà‘èã¿ æ ¢€¤à"€æ @lÍ¢` „ /Ä.`’¢@@l‘”æ €¤à"€à @l¾„ ;Ä,`¢` ’¢@@l‚”à €¤ € @l¯„ ?Ä,`°`´@lv“èÇàèã¿ ÿÿ² @ : ¢ÿÿÆ’À,@Çà‘èã¿ @lŒÐ Ä ÄH €  €@ IÐ $ ÿü]¦€¢"€(æ& ¦@l|€#æ& @l{Ð  @lxÐ $¨¢@  Ò ª¦@l<”„ /Ä-@„@Ò $ @l5”†@„ Ä(àÿü;€¢"€æ& ¦@lZæ& @lWÐ @ö’ Ð& Çàèã¿ @lJÐ @ Ð& ÿÿ¸èã¿ @l>Ð $@ Ð& $ÿÿ¬èã¿ @l2Ð @l0Ð @l.Ð Ä €  "€Ä @l(Ð Ä €  "€Ä @l"Ð Ä €  "€Ä (@lÐ Ä (€  "€Ä ,@lÐ (Ä ,€  €@lÐ ,@lÐ @l Ð $@l è㿘@ 3 ¨€ G@kâСˆé–’¡@ ÿàL”Çà‘è Fª£àÄ£à€  "€ì éÔ ¡Hÿà{’ì Ä Æ ®€€¥€€t¤ Ѧ °¡ì¢”%À@l’ ˆ€†€¬† ¬€¤@€€ ÀÄL`„ ÿ…( Ä€€ˆ @€€ À¢`€¤@€ € ÀÄL`„ ÿ…( Ä€€ˆ @2¿ÿø¢`€ À€€ ÀÄHÿÿ„ ÿ…( Ä€€ˆ @€€ À† à€ À€ € ÀÄHÿÿ„ ÿ…( Ä€€ˆ @2¿ÿø† à€ À€6€¥€@ ’ĸ¢€  € ’¿ü²Ð¸@1’¢@k˜’¿üÿýb²€ÿþmпü锘’¡` ÿßÞ–@k‡€€¥€@kƒ@! ¢’ @ke” À$`€¤ €ò$`¤€¦â$ঀ¥€ ¿ÿ”¢@ Çà‘èã¿  €â Ä €  "€Ä ÿÿ/Ð Ä €  €@k\Ð @kZ €¤`2¿ÿðâ Çàèã¿@kP %F@ iУ쒿x  ?øœ#€ `¦ ?øœ#€ `¨@k‰€€Ä¿Œ<„€ € €€$ä£ì骡x逤 €¬¡€ $ ’”@ka–’”@k\–¤@kñ’€¤ ¿ÿñ $ é’¡ˆ”@kO– @kå’Çàèã¿@k ÄN†€  /€ € À€ € À† àÄHà€  /€€ À2¿ÿü† à€ À€ÄHà€  /€Çà‘è @ê’ @k9’¿x€€Ä¿Œ<„€€ €€F@jàÇà‘è Ä£à€  €é¡ÿßg’@k%@ 3¢€ G@j±Ð¡ˆé–’¡¼ ÿß”@jÄÇà‘èÒJ ”€¢`€ – ÒJ ” €¢`/"€–àÒJ €¢`2¿ÿúÒJ Ãà 㿘Ä €  € ¤ Ä ÄH €  €¤ ä €-F-FÄ£€  €-¦£Ä ÄH è „ /€ ª`?ÿ ÿÿ×Ä£† € €&€Æ£€ à€ÄM@€  € ÄL €  /"€† à€ à€  ÄL €  2¿ÿøÄL @j  ?øœ#€ `¨@jž’€ 9Ä ÄH Æ „ /€ „`?ÿ¨À9¬£DÄà€  "€3Äà @jiÐà  @jfÐ  @ €Ð „  Äà ?øÄH œ#€ ` €  .€ ªÄà ÄH €  2€Ôà @juÒ €Ôà é’¡Ä@jƒÖ ÿû+Ð Ä € €"€ÄM`@jB„ :Ä,„ @ vÒ €ÄM`ÄH €  .2€ êà Äà ÄH €  €ª¿ü€ÄM`êà ÄM`€  €@j( @j%„  ÄM ?øœ#€ `€  /€ †€é† é’¡Ì–”@jK˜¨ÿùç@j ¦„"€Ä $†ÀÄHÿÿ€  /"€À(ÿÿÄ $ÄH €  €¢ €€¤ â $€¤ €ª @iøª @iõ @iò„„€@‹ ÄLà€  € † €é† é’¡Ô–”@j˜€¤ € €¤Àé’¡Ü@jN@jK’€¤À€@iÎÇà‘èã¾ ÄN ˜¿¿€  €0€¦`Ò’š¡ìÄJ`– %” „ ÿÄ€ €ˆ "€ÄJ`ÞJ`’`„ àÿ…8 €   €Ö* „ 0€Ä* „ 7Ä* „ à€   6€„ 7„ 0€Ä* Ä* ”  €ÄJ`Ä* ’`” ÄJ` €  €€¢¡*¿ÿÛÄJ`€¦`€+„" € ¡€(„" „ ?Ä*  ÄN`€  €!„" ”" €¢¡€„" ’ÄN`† F– %š 2€  /2€ ÄJ`Ö* ’`” Ú* Æ*  €ÄJ`Ä* ’`” ÄJ` €  €€¢¡*¿ÿíÄJ`„" € ¡:€À/¿ÿ€À* @)¿Çà‘èã¿ %FÄ¢ü€  €¢¢üÿþ«  ¦€€¤ Ä $ÄH €  €  È $€Ä 9ˆ£`Ä €  € „ Ä ÄH €  €„ Ä €ÿÿt’¦€¤ 2€Ä`Ä`ÄH €  .€Ä`ÄH €  "€Ä`@i1Ð` @i.„@È éÔ` ’¡à@i^–@i Ä`¦€  €Ä`\€  € Ä`耠 €Ä¢ü€  € @#€€@&€€ @U @iÇà‘èÇà‘èã¿ é’¡èÿúœ°"Çàè•* –•: €¢@ ‘* € •: ÐJ`€¢ € ’"`€¢@ 8¿ÿûÐJ`€’ ’ Ãà ã¿ ÄN ¢¨ €  /"€¢ @hÚ„@ ¦ ÄL €  .2€ÄL ÄL €  /"€ÄL ÄL €  2€ÄL ÄL €  /€ ¨ ”$À’ @hä¦$à¿ÿìÄL À, Çà‘耠 .2€3ÄL ÄL €  .2€/ÄL ÄL €  /€¤ÄL €  2€'ÄL ¤€¤(€ÄL ¤$ €¤€(€ÄL ÄL?þ€  /€ ¤$ €¤€€ÄL¿ÿ€  /2¿ÿû¤$ ÄL €  /€ ¨   ”$À@h²’„$ ¦$À¿ÿ¸ÄL À, Çà‘耠 /2€ÄL ÄL €  /€¤¤ ÄL €  /"¿ÿþ¤ ÄL €  € ¨ ”$À@h–’„$€¦$À¿ÿÄL À, Çà‘耠 "€ÄL ÄL €  /€   ÄL €  €ÄL €  /2¿ÿú  ÄL €  €  ¿ÿ„ÄL Çà‘èã¿ €€Þ ÿÿSÄN`€  2€ÄN`@ 耠 ?€¦¨$Àª@à`¦’@h ”À’@h”À,ÀÇà‘èÄN`€  #€@hJ’ #„€¨ €@h-„¨ €ª@Å`¦’@gñ”À’@gí”À,ÀÇà‘耦 €*® /ÄN`€  /2€'ÄN`ÄN`€  /2€#ÄN`”$À@h5’ /†"€†ÄJ €  /2€†€¨ À¨ Àª@ž`¬¦€¥ "€€’@gÆ”€’@g”À-€Çà‘èÄN`€  /€Kª ”$À@h’ /†¨ €€¥ €€ àÄHà€  /€ à”$À¨ @h’ /†¿ÿõ€¥ € à€€¥ €€ àª€¨%@€ à€€¥ €€ àª€¨%@€ à€€¥ €€ àª€ ¨%@€ à"€¨%@€¥ 2€ª¨%@ª@T`€¥ ¬¦€€¦ ’@g|”€¦ "€6À-€€’@gu”À-€Çà‘è’ÿþ¬” /†€„ઠ€¨ €€¢€ „ ÄJ?ÿ€  /€„ „ઠ€¨ €¨ €¬@) €¥ °¦€€¥`’@gQ”€¥`€€¦ „î(¿ÿ"€À.’@gF”À.Çà‘è°@l“î@ã¿ ÿø'¤ €"€¤ @gf´ÿÿ—èã¿ Ä 7¤¢¨ ‡( ¦ „ À†`(…( ì€Ä ‡( „ À7…( †à$ò€ÿú`€¦`€Š®Ä (€  €ÿö`Ð (Ä ,€  € ¨€¤ €9€¦£lÿöUÐ ,¦@g7 @g4Ð „„€  Ä ª€ €€€¥ @ GÐ €¥ „ ª€ @g#„ €¤à€ª@@g„ ª@@¶°@g ’@fÞ”€¥ € @g ²’@fÔ”†€¤à€„ @„ :Ä,²à@fþ ’@fÆ”†@„ @Ä(à à@fóÐ`Ò`´@f»”Ä` ²€ €€ „ :Ä.€`@ Ò` ²ÿú ’„@„ „ €€ €€!À-À€¥ € €¤àÄ`(€¥€€¤à@f΀¤à€ €¤ €Ä`,€¤À€@fÂÇàèé¡ìé’¢@f‡”'¿ÿsÄ (é¢é’¢@f”'9¿ÿÜ€¥ ã¿ „€€¦ €F  €€¤ FÄ㈀  €éà㈀€¤ @g¢$ € €¤ Ä㌀  €éà㌀€¤ @g ¢0 €¤ "€  ÄL €  "€  ÿ÷ˆ€ E’ ¡ @fÛ”$À,#ÿÇà‘èÇà‘èã¿ „€’Çà‘è ÿºÀ„ €"€„ Çà‘èã¿ é¢@f<¢<’ ÿÚ·” ª ¬ ˆ €¦`€ †Äà€  2€ˆ Æà€ à2¿ÿûÄà€¡ €é@f$¢P²ÿÙî‘è @y®€ é@f¢`²G@f%Сˆ° ¶ÿÚ‘•è @{’F°£èģ耠 €„€@F’@f|€€%GÄ¡ˆ€  €éé@e÷¢€ @fСˆ’– ÿÚn”@½‘èé’¢œ@f@²€é@e䢠 G@eïСˆ’– ÿÚZ”@©‘èæà€¤ €”¤ÈàРÄàÆ € À€†Ä €  €¨Ä?ø€  "€yä Ä Ò é¢ôÿÚ{Ô €qä ”%’ ¦@fr–Ä €  € €  €ˆ€  "€ Ò €_ä "€1Ä €  "€SÒ €Xä @~@­´Ä  ¶…0 €ˆ € Ò ”@,–¦€ Ä?øÒ ”Ø  @h–Ä?ø¦€  € Ä ”Ò éÖ £ÿÚ=˜@eª@e¨¬ €.ä ô @ PÄ  ¶…0 €ˆ € Ò ”@–¦€ Ä?øÒ ”Ø  @?–Ä?ø¦€  €éÔ ’£DÿÚ–@eƒª`€ ä é–£|@æ”ä ¦€¤ 2¿ÿzÈà€ ÄàÄ?ø€  "€ÄàéÿÙþ¢ÀÄàÆà„$À€ €€ Äà’ Æà„$À” À@eï–@e@é´²£€° ÿÙª—è@ee¿ÿÚä ã¿ ÄN`€  /€é@‘謣œÄN €  /€R ˆ ÄN€  "€ÄNÄN@€  "€ÄNÄN@ÆN€ À2€ ÄNÄN€  /"€ ÄNÄN@€  /"€ÄNˆ ¿ÿëÄN€  /€ ¢ ÄN@€  /€¢ ˆ ¿ÿàÄNÄN€  € ¨@†ÄHà€  /€†à¢`ÄHà€  2¿ÿúÄHà¨@¤ @e…,`„ €„€@ª ª€¤`€ …, ¦’¤ @dД ¦à€¤€¿ÿú’…, „ €@@e’Çà‘è飈é’£”@d¼”(-¿ÿª 㿘@dé €¦`€¦   ?øœ#€ `¤@e’„€  é@dý’£ €)7 )7 ?øœ#€ `¤@dó’€é@dï’£¨à \€¤ €€¤àÐ @d”’€"€¦ à €¤ 2¿ÿùÐ €€¤à€¤à€@e‡’€€é@d‚£° G@dСˆ’”˜ ÿØ÷–@@  @aÐ$ Ä \Ä$ à% \Çàè㿘ÄN €  "€ ¢ÄN ¤ª ¨ "€  '2€Ä èN ª ¢ Ä ¤&`„   €$Ä& Ä † Æ& è( @dµ’”¿ü–¿ø@>’€€¢@Ä¿ø’ пü” €@dþ–€¥`2€¢`Ä „   € Ä& Ä † Æ& è( Çà‘è@dÓ’¿ÿà@dÎ’Çà‘è㿘@p  @dP„” é ?ø’£Ðœ#€ ` @d~–’”ÿÿ¨–Çà‘èš ˜€¢ €’ ÄK €  #€€  &€ ’ € ˜ €¢`€’ Ø" Ú"àÃà ’ ˜ €£ *¿ÿïÄK Ãà 㿘GÄ €  € @ ÆÇà‘è@û’ ?¢€+¤@d…,`¦ÄN à ?øœ#€€   `¨¢€„$@ÄL † Fˆ % 3€  ?"€È,`ÄL Ä,`¢`€¤ Ð,`¤ Æ,`¢`ÄL €  2¿ÿòÄL „$@€ €€ éÀ,`€ @ “Çà‘è£Üé’£ô@c«”)$¿ÿõÀ,`€¢ € €¢ €7€¢ € 7€€ 7€¢ € 7€ Ãà``Ãà`dÃà`hÃà`lÃà 㿘€¦ €%FÄ¡ €  2€Ð¡ Çà‘è ÿ´’Ð'¿ü„2€Ä Çà‘è Ä¡ €  2€Ð¡ ÿµ. Ð$¡ Ð¡ ÿ³ð’„€Ð'¿üÄ Çà‘èÿÿÂÐ'¿ü@]’С ÿ´N”¿ü„ Çà‘èã¿ @c‹Çà‘è ã¿ !FÄ! €  € ÇÐ! ’ 8ÿ´¾” ÿ³Ð! À$! Çàèã¿ ÿ×Á é@cD£üG’Ô < ÿ×½–@c-‘è ã¿ @d7 €êÿÿç Çà‘èã¿ „€†@d+’ €€¤ @d# €¤ €êÿÿÒ  Çà‘èã¿ @d €êÿÿà(Çà‘èã¿ ÿÿðÄJ €  €ˆц£ìÄHà„ ÿÄ€Ä(à†àÄHà€  2¿ÿúÄHàÇà‘è–ÐJ “*`“:`“*`€¢ “:`€ ˜ ÐJà€¢ €–à˜ ÐJà€¢ 2¿ÿúÐJàÃà ã¿ ¤&@ÿÿ¢  ’@bΔÀ,Çà‘èã¿ ¤€FÄN €  €BÄN ¨   ª€  €.„ Ѧ ¬¡ìÄL ¢ €  ,€ “,àÿÿ ÿÿÚ’Ð$¢`¤ À$¦à¨ ÄL „ ÿ…( Ä€€ˆ @"€ª¤ ÄL „ ÿ…( Ä€€ˆ @2¿ÿû¤ ª€ÄL ¤ ÄL €  2¿ÿÜÄL „ “( ÿÿh£-  ¦ÿÿ³’Ð$À$àÇà‘èÇà‘è 㿘@b€¢?ÿ€Ð'¿ü„ FÄ(ᤄá¤Çà‘è@b¥¿üFÔ „ á¤êÖ ’à0@bÑØ Çà‘èã¿@b¤€¢?ÿ€Ð'¿ü„ FÄ(᳄á³Çà‘è@b‡¿üÆ „Æ# \Æ Æ# `Æ ”çlÆ Ø  –àF á³ê’à@@b¬Ú Çà‘èã¿ %FÄ£€  €  ê  @¶ `Ð$£@cB€¢ €+ꀢê@b. t@bõ’€¤ €&ê@b& ˜@bíÒ£€@c.꠼꒠ÈG@c*” Hê Ìê’ ØG@c#” Xê° Üê² èG@c•è h@bÞ l@aø ¿ÿå@aô ¿ÿá㿘ò'¿ü’¿øò'¿ø@c€¢?ÿ€ G@bСˆê–’ ì ÿÖn”Çàèã¿’¿x¤ @bf€€#Ä¿Œ<„€(€ €€FÄ£à€  €ê üÿÖ’@bN¤€ê@aÍ¡ G@aØСˆ’– ÿÖC”Çà‘èã¿ @bÕ’ …2 ° Çàèã¿@b4’¿x€"€Ä¿ŒÇà‘è <ˆ „€€ €"€ˆ Çà‘èã¿ ¤€@aÏ @é„ÿþf ê ’¡<”@aü–€ÿþ€ ÿÿÏ€€Çà‘è@a²Çà‘è ã¿ ¢ ’ÿÿÛ¢`„¿ÿü’Çà‘è㿘@a¡ ¤ ?ø¦ /œ#€ `¨@a¼’ÄM „ /€¤€¢d¿ÿÄM€  "€ÄMÄM€  /"€ ÄM††àÄHà€  €¢`ÄHà€  /¿ÿú†àÄM€  "€¤ À-ÿÿŽ€€ €¤ @bb’!ÿ€€€¤ Çà‘è?ÿ€æ-¢`¿ÿÙÄMÇà‘è ã¿ @aî’ /„€¢"ÿþ ‘è@a]„`„€ÿýö  ’@a"”†„ /Ä,@à@as’Çà‘èã¿ @aF† "€ÄNÄN€  /"€ ÄNˆ† à€ˆ! ÄI €  /2¿ÿü† àÄN€  /2€F„àF Äã$€  €¢ã$Ä`€  €’Ðã$@” €€ ’Ð`@¼” €€„ Çà‘è „ Çà‘èðã$²@°•è Ä`€  € ’Ð`@©” €€„ „ Çà‘è„ Çà‘èÔJ –€¢ "€ÐJà˜ ÒJ`€¢`"€ÐJàÔK ÒJ €¢@ €–àÒJà€¢`€ ˜ ÒK €¢`€ÔK ÒJà€¢@ "¿ÿõ–àÐJà’ €¢ "€’ Ãà ã¿ Ä ¤€  "€)ð Ð ¦ ÿ’€€ ’Рÿ½” €€€¤ €¤à€ † Ä ÄH €  /€† † €Ä Ä €ÿÿº’€€¤ Ä €  2¿ÿÞРð Çàèã¿ ¢ €Œ`€FÄL €  /"€  FÄã0€  € ¤ã0Ðã0’ÿÿÀ”€2€Ä¿üÇà‘è Ä¿ü€  € ’пüÿÿ´”€€Çà‘è Çà‘è ã¿  ¢@`ƒ¦¤@`ˆ€¤à€„ €¢ €„ „’@ÄJ`ÆJ € À€ ¤¤  €ˆ! ’"`" €¡ 6¿ÿ÷ÄJ`„ €¡?ÿ"€„ Çà‘èã¿ Ä  €  €'¢Ð ÿ‘£€€ ’Ð ÿD” €€  Çà‘è €¦ "€ Ò Ò ÿÿÀ€   Çà‘è @`€"€ „   Ä €  2¿ÿàÐ €„ „ Çà‘èã¿ @`.ˆ†"€ÄNÄN€  /"€ÄNÄN€  ."€ÄN†ˆ¡ € † àÄHà€  /€ÄHà€  .2¿ÿøˆ¡ ÄN€  .€† „ †Çà‘èã¿ ÿü¤ R¨¤’ R¢ @`ñ”€¦ R€€¤`@_ú¢„@€ ¨€„€ÄH¿ÿ€   €§,àÿü—’¤¨€’$À@`Ù”€¿ÿ쀤`€ Ä €ˆ  €„`€ €€°ÿü‚“è@_Õ¤ Çà‘èã¿ÄN €  -€ ¦ ÄN €  €G@`  H¤¦ €€¤ @`¶’ ¤€¤ €Çà‘è ÿüX ’¿x¨@`k€€Ä¿¨Ä%  ” – ˜Ò @`¢š Ð% Ä € ¿ÿ€ €¤à€„ @_„ Ä% Çà‘èÀ% ¢"ÿü8"…4`Ð% Æ „@…8 € À$€Ä Ð £,`ÿü7’Ð% Ä Æ ’€Ä ”$@@_~€¢ €Ä „€Ä% ¿ÿè…4`€€¤à2€Ä @_UÄ €¤@$€À% Ä €  "€À% Ð ÿüÒ Ð% À% Çà‘è€@_B@_aÐ @__¨ Çà‘èã¿ Ä €  €Ð @`PÒ @_Rè@_PÐ @_Nèã¿  €Ä €  € ¢Ð`@_C¢`Ä`€  2¿ÿüÐ`@_=èÇàèã¿  €€¦`Çà‘è2€Ä`Çà‘耠 €¤ @_,Çà‘èÄ €  € ¦ †† Äठ€  ¿ÿý†à¦ Ä`€  € „€††`Äà¦à€  ¿ÿý†à„€„ “( ÿû¹…, ¢„à•( @^×’@_Çà‘èã¿ ÿûœ ¦¢ÿû¼Ð$ऀ¦ €À$àÇà‘èÄ €  €â`Ä`€  2¿ÿþâ`æ$`Çà‘èã¿ ÿû~  ÿûŸÐ$ ð$ Çà‘蔀 – Ò Ö" – ” €¢`2¿ÿüÒ Ãà ã¿  €¢Ð @^—’€"€ „ à €¤ 2¿ÿùÐ €„ „ Çà‘èã¿ ¢€ à`@^±Ð`@^¯¢€¤ 2¿ÿúà`Çàèã¿  ¢ÿ¯’€€ ÿûb9²´£xÿ¯R‘èÇàè‚ÿ®üžã¿ @^‰Çà‘è ã¿ Ì’ @ÿ¯Á” ÿ® èã¿ @^x@^vÇà‘è ã¿ ̲ „ÿ¯¯•è ã¿ ÄN ¢1F¬!Ǥ€  -€ª„ -Ä.!Ǥ ª`@^c*ªª ®¢«@_Z’…2`‡( „ À† $€¢ $€ ÄM@ÄM`ˆÄ, †àˆ ¤ € À&¿ÿûÄI ÄM@€  "€"À,   ¦¨ ,ª@@^¥’„ ‡< …8 „ €‡( „ À€¤2€ÄM`€¤à"€ÄM`è, ¤ ÄM`ª`  Ä, ¤ ¦àÄM`€  ¿ÿèÀ, Çà‘è㿈’@]¿èÿÿ±¿èÇà‘èã¿ ª¨¢ ¦” – @_’„`0…( ” …8 – Ä,à@_’¦à¢`ª¨ €’@¿ÿî” …4`„@•8 €¢ $€À.„$`ˆÄI ’ ÆJ ’`€¢@ Æ) ˆ Ä* " &¿ÿùÄI À.Çàèã¿ ’”ÿÿÌ¿€ÿÿw¿€Çà‘èã¿  ¢ €™™  ¢ ¤¢g@^=’‡< …:`  €€¤ € ¢`@^3’‡< …:`  €€¤ 4¿ÿù¢`Çà‘èã¿ ˆ ¢€€¤ „ -Ä.   ¢ €¤ €„ 0Ä,`„`€"À( €¤ d€™™@^’¢g‡< …:`„ €† 0Æ,`‡( „À…( „$„ 0Ä,`„`€À( €¤#è€"zá@^’¡‡< …:`„ €† 0Æ,`‡( † À‡(à„€…(  $™™@]ñ’¢g‡< …:`„ €† 0Æ,`‡( „À…( „$„ 0Ä,`„`€ëÀ(  „£€¤€1“@]Û’¡Ó‡< …:`„ €† 0Æ,`‡( † À‡(à„€…(  $zá@]Ì’¡‡< …:`„ €† 0Æ,`‡( † À‡(à„€…(  $™™@]½’¢g‡< …:`„ €† 0Æ,`‡( „À…( „$„ 0Ä,`„`€·À( a„¢ €¤€B6â@]§’£­‡< …:` „ €† 0Æ,`‡( †À‡(à† À‡(à„€…(  $“@]–’¡Ó‡< …:`„ €† 0Æ,`‡( † À‡(à„€…(  $zá@]‡’¡‡< …:`„ €† 0Æ,`‡( † À‡(à„€…(  $™™@]x’¢g‡< …:`„ €† 0Æ,`‡( „À…( „$„ 0Ä,`„`€rÀ( Є¢@€¤€U>-@]b’¡‰‡< …:` „ €† 0Æ,`‡( †À‰(à†!‡(à†€‡(à„€…(  $6â@]O’£­‡< …:` „ €† 0Æ,`‡( †À‡(à† À‡(à„€…(  $“@]>’¡Ó‡< …:`„ €† 0Æ,`‡( † À‡(à„€…(  $zá@]/’¡‡< …:`„ €† 0Æ,`‡( † À‡(à„€…(  $™™@] ’¢g‡< …:`„ €† 0Æ,`‡( „À…( „$„ 0Ä,`„`€À( &%„¢€€¤€fÆ÷@] ’¢ƒ‡< …:`„ €† 0Æ,`‡( † À‰(à†!‡(à„€…(  $>-@\ù’¡‰‡< …:` „ €† 0Æ,`‡( †À‰(à†!‡(à†€‡(à„€…(  $6â@\æ’£­‡< …:` „ €† 0Æ,`‡( †À‡(à† À‡(à„€…(  $“@\Õ’¡Ó‡< …:`„ €† 0Æ,`‡( † À‡(à„€…(  $zá@\Æ’¡‡< …:`„ €† 0Æ,`‡( † À‡(à„€…(  $™™@\·’¢g‡< …:`„ €† 0Æ,`‡( „À…( „$„ 0Ä,`„`€±À( }x„¡€¤€y×ò@\¡’¢k‡< …:`„ €† 0Æ,`‡( † À‰(à†!‡(à„€‡( „À…(  $Æ÷@\Ž’¢ƒ‡< …:`„ €† 0Æ,`‡( † À‰(à†!‡(à„€…(  $>-@\}’¡‰‡< …:` „ €† 0Æ,`‡( †À‰(à†!‡(à†€‡(à„€…(  $6â@\j’£­‡< …:` „ €† 0Æ,`‡( †À‡(à† À‡(à„€…(  $“@\Y’¡Ó‡< …:`„ €† 0Æ,`‡( † À‡(à„€…(  $zá@\J’¡‡< …:`„ €† 0Æ,`‡( † À‡(à„€…(  $™™@\;’¢g‡< …:`„ €† 0Æ,`‡( „À…( „$„ 0Ä,`„`€5À( 沄¢€¤€ŽyŽ@\%’£‰‡< …:`„ €† 0Æ,`‡( † À‡(à† À‡(à† À‡(à† À‡(à„€…(  $×ò@\’¢k‡< …:`„ €† 0Æ,`‡( † À‰(à†!‡(à„€‡( „À…(  $Æ÷@[ý’¢ƒ‡< …:`„ €† 0Æ,`‡( † À‰(à†!‡(à„€…(  $>-@[ì’¡‰‡< …:` „ €† 0Æ,`‡( †À‰(à†!‡(à†€‡(à„€…(  $6â@[Ù’£­‡< …:` „ €† 0Æ,`‡( †À‡(à† À‡(à„€…(  $“@[È’¡Ó‡< …:`„ €† 0Æ,`‡( † À‡(à„€…(  $zá@[¹’¡‡< …:`„ €† 0Æ,`‡( † À‡(à„€…(  $™™@[ª’¢g‡< …:`„ €† 0Æ,`‡( „À…( „$„ 0Ä,`„` €¤À( . @[™’£¡‡< …:`„ €† 0Æ,`‡( † À‡(à†€‡(à†€‰(à†!‡(à†€‡(à„€…(   $yŽ@[‚’£‰‡< …:`„ €† 0Æ,`‡( † À‡(à† À‡(à† À‡(à† À‡(à„€…(  $×ò@[m’¢k‡< …:`„ €† 0Æ,`‡( † À‰(à†!‡(à„€‡( „À…(  $Æ÷@[Z’¢ƒ‡< …:`„ €† 0Æ,`‡( † À‰(à†!‡(à„€…(  $>-@[I’¡‰‡< …:` „ €† 0Æ,`‡( †À‰(à†!‡(à†€‡(à„€…(  $6â@[6’£­‡< …:` „ €† 0Æ,`‡( †À‡(à† À‡(à„€…(  $“@[%’¡Ó‡< …:`„ €† 0Æ,`‡( † À‡(à„€…(  $zá@[’¡‡< …:`„ €† 0Æ,`‡( † À‡(à„€…(  $™™@[’¢g‡< …:`„ €† 0Æ,`‡( „À…( „$„ 0Ä,` „` À( Çà‘è‚ ÿ÷.žã¿ ÿÿ÷@ °Çàè‚@Z|ž㿘¿ø@[€’ Ä¿øÄ& Ä¿üÄ& Çàè㿘¿ø@[v’ Æ Ä¿ü  €“@ZÍ’¡Ó‡< È …:`„ €Æ¿ø† À‰(àˆ!‰) †À‡(àÇà‘èÀÃà ã¿ ÄN †€  €#ˆ ÄHà€  &2€ÄHàˆ €†à€  <"€ˆ ÄHà€  >"€ˆ ÄHà€  "2€ÄHàˆ € †à€   2€†àˆ €†à†àˆ ÄHà€  2¿ÿâÄHàÿöË ÄN †®€  "€NÀ(à˜ pÄN ’ &š #ž 3¢ 2” ;¤ q¦ u¨ o– tª a¬ m€  <€ €   "€+Ò(à€  ""€ Ò(à€  &"€ Ò(à€*ÄJ "€Ò(à€  >"€ Ò(à€#ÄJ ê(àì(àØ(àÔ(à†à€ ÄJ ˆ g€  <"€ˆ lÈ(àÖ(àÔ(à†à€ ä(àæ(àè(àÖ(àÔ(à†à€  Ú(àÞ(àâ(àÔ(à†à€ Ä(à†à ÄJ €  2¿ÿÅÄJ À(àÇà‘è㿘FÄ£€  €GÇà‘è @Z h’ h@ZÔ”¿ø€6€Ä¿úÇà‘è Çà‘è?ð@ßÿÀ㿘#FÄbH€  €@YÎ @Z„ Ä$bH@ZÁÐÐ# `Å£hÐð# dÉ£p… ˆDÉ dÍ `‰  ‰¡ F…¡ Â… BÅ# \ð \Çàèã¿ @k¼ÐàÀà?øâ?ð€¤€ŸÄ€¤@€ŸÄ@Çàèã¿ @kˆÐàÀà?ü€¤€Ò ŸÄÐ@k<ÐàÀà?üâ?ô€¤€ŸÄ€¤@€ŸÄ@Çàè);Ok•Å[ÉWQñ  Ý/?"!,i9¿Ka~ë¥Öj½בe  7C×Aä¥ ½«Šf©!*í©7ΑHŒŸ^P}z›åŸdKÏ5¡ _U^/%Ç=kOÏÝ[Gè)é6…šFû•\I (‘«ŠQÛšKƒâ5Þ¦5)n>ƒ5Ü#F¡[ëuvT~ç™Ô>¥ÇúQwCBBBBQ00000000000000000000000000000000  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~€‚ƒ„…†‡ˆ‰Š‹ŒŽ‘’“”•–—˜™š›œžŸ ¡¢£¤¥¦§¨©ª«¬­®¯°±²³´µ¶·¸¹º»¼½¾¿ÀÁÂÃÄÅÆÇÈÉÊËÌÍÎÏÐÑÒÓÔÕÖ×ØÙÚÛÜÝÞßàáâãäåæçèéêëìíîïðñòóôõö÷øùúûüýþÿ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~€‚ƒ„…†‡ˆ‰Š‹ŒŽ‘’“”•–—˜™š›œžŸ ¡¢£¤¥¦§¨©ª«¬­®¯°±²³´µ¶·¸¹º»¼½¾¿ÀÁÂÃÄÅÆÇÈÉÊËÌÍÎÏÐÑÒÓÔÕÖ×ØÙÚÛÜÝÞßàáâãäåæçèéêëìíîïðñòóôõö÷øùúûüýþÿconnection_host_name == NULLconnect.cconnection_host_name != NULLconnect.cConnecting to %s[%s]:%hu... Connecting to %s:%hu... connected. Created socket %d. failed: %s. Closing fd %d Master socket fd %d bound. Closing fd %d Closing fd %d Created socket fd %d. Closing fd %d Closing fd %d Deleted old cookie (to be replaced.) Stored cookie %s %d %s %s %d %s %s %s res != 0cookies.cDiscarded old cookie. name_b != NULL && name_e != NULLcookies.cdomainpathexpiresmax-age%lfsecureError in Set-Cookie, field `%s'Syntax error in Set-Cookie at character `%c'. Syntax error in Set-Cookie: premature end of string. cdm: 1 2 3 4 5 6Attempt to fake the domain: %s, %s Attempt to fake the path: %s, %s p != NULLcookies.cocnt == countcookies.cCookie: pos == result_sizecookies.crCannot open cookies file `%s': %s TRUE%lu%s %s %s %s %lu %s %s Saving cookies to %s. wCannot open cookies file `%s': %s # HTTP cookie file. # Generated by Wget on %s. # Edit at your own risk. Error writing to `%s': %s Error closing `%s': %s Done saving cookies. bytecon != NULLftp.ccon->target != NULLftp.c!((cmd & DO_LIST) && (cmd & DO_RETR))ftp.c(cmd & (DO_LIST | DO_CWD | DO_RETR | DO_LOGIN)) != 0ftp.cuser && passwdftp.cLogging in as %s ... Error in server response, closing control connection. Closing fd %d Error in server greeting. Closing fd %d Write failed, closing control connection. Closing fd %d The server refuses login. Closing fd %d Login incorrect. Closing fd %d Logged in! ==> SYST ... Error in server response, closing control connection. Closing fd %d Server error, can't determine system type. done. ==> PWD ... Error in server response, closing control connection. Closing fd %d /Initial VMS directory not in the form [...]! Preprocessing the initial VMS directory old = '%s' new = '%s' done. ==> TYPE %c ... Error in server response, closing control connection. Closing fd %d Write failed, closing control connection. Closing fd %d Unknown type `%c', closing control connection. Closing fd %d done. ==> CWD not needed. changing working directory %s%s%sPrepended initial PWD to relative path: old: '%s' new: '%s' *ntarget == '/'ftp.cChanged file name to VMS syntax: Unix: '%s' VMS: '%s' ==> CWD %s ... Error in server response, closing control connection. Closing fd %d Write failed, closing control connection. Closing fd %d No such directory `%s'. Closing fd %d done. ==> CWD not required. ==> SIZE %s ... Error in server response, closing control connection. Closing fd %d done. ==> PASV ... Error in server response, closing control connection. Closing fd %d Write failed, closing control connection. Closing fd %d Cannot initiate PASV transfer. Cannot parse PASV response. Closing fd %d couldn't connect to %s:%hu: %s done. ==> PORT ... Error in server response, closing control connection. Closing fd %d Write failed, closing control connection. Closing fd %d socket: %s Closing fd %d Bind error (%s). Invalid PORT. Closing fd %d done. ==> REST %ld ... Error in server response, closing control connection. Closing fd %d Write failed, closing control connection. Closing fd %d REST failed; will not truncate `%s'. Closing fd %d REST failed, starting from scratch. done. ==> RETR %s ... Error in server response, closing control connection. Closing fd %d Write failed, closing control connection. Closing fd %d No such file `%s'. done. ==> LIST ... Error in server response, closing control connection. Closing fd %d Write failed, closing control connection. Closing fd %d No such file or directory `%s'. done. Lying FTP server found, adjusting. accept: %s %s: %s Closing fd %d Length: %s [%s to go] Length: %s [%s to go] (unauthoritative) %s: %s, closing control connection. Closing fd %d %s (%s) - Data connection: %s; %s (%s) - Control connection closed. Closing fd %d %s (%s) - Data transfer aborted. Closing fd %d r%s: %s %s File `%s' already there, not retrieving. (try:%2d)--%s-- %s %s => `%s' Closing fd %d %s (%s) - `%s' saved [%ld] %s URL: %s [%ld] -> "%s" [%d] Removing file due to --delete-after in ftp_loop_internal(): Removing %s. unlink: %s Closing fd %d .listingUsing `%s' as listing tmp file. unlink: %s Removed `%s'. Recursion depth %d exceeded max. depth %d. f != NULLftp.cRemote file no newer than local file `%s' -- not retrieving. Remote file is newer than local file `%s' -- retrieving. The sizes do not match (local %ld) -- retrieving. Invalid name of the symlink, skipping. Already have correct symlink %s -> %s Creating symlink %s -> %s symlink: %s Skipping directory `%s'. %s: unknown/unsupported file type. %s: corrupt time-stamp. Unrecognized permissions for %s. Will not retrieve dirs since depth is %d (max %d). %s%s%s/%sComposing new CWD relative to the initial directory. odir = '%s' f->name = '%s' newdir = '%s' Not descending to `%s' as it is excluded/not-included. Rejecting `%s'. %s: %s No matches on pattern `%s'. Wrote HTML-ized index to `%s' [%ld]. Wrote HTML-ized index to `%s'. Closing fd %d %s %s %s%s%s PASS--> %s --> PASS Turtle Power! --> %s USER331 s/key 331 opiekey PASS%d,%d,%d,%d,%d,%dPORTPASVTYPECWDRESTRETRLISTSYST VMSUNIXWINDOWS_NTMACOSPWD""SIZEtype=JanFebMarAprMayJunJulAugSepOctNovDecrb%s: %s total PLAINFILE; DIRECTORY; SYMLINK; UNKNOWN; implicit perms %0o; perms %0o; month: %s; day: %d; year: %d (no tm); time: %02d:%02d:%02d (no yr); -> link to: %s ... Ignoring `.' and `..'; trailing `/' on dir. trailing `@' on link. trailing `*' on exec. Skipping. rb%s: %s Name: '%s' -- :MYYYY/MM/DD HH:MM - %d/%02d/%02d %02d:%02d Timestamp: %ld Directory File, size %ld bytes wrong VMS permissons! JANFEBMARAPRMAYJUNJULAUGSEPOCTNOVDECrb%s: %s file name: '%s' .DIRName: '%s' Directory File Getting additional line empty line read, leaving listing parser confusing VMS listing item, leaving listing parser second token: '%s' -day: '%s' -nonsense in VMS listing, skipping this line date parsed YYYY/MM/DD HH:MM:SS - %d/%02d/%02d %02d:%02d:%02d Timestamp: %ld ,)confusing VMS permissions, skipping line permissions: %s -> 0%o rb%s: %s Unsupported listing type, trying Unix listing parser. wb%s: %s %s%s%s@ ���Index of /%s on %s:%d���

Index of /%s on %s:%d

  %d %s %02d %02d:%02d         time unknown       File        Directory   Link        Not sure    %s  (%s bytes)-> %s
store is `%s' POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c %s index >= al->faulty && index < al->counthost.cindex == al->faultyhost.ccount > 0host.cReleasing %p (new refcount %d). Deleting unused %p. Caching %s => %s Found %s in host_name_addresses_map (%p) Resolving %s... failed: %s. done. u->host != NULLhost.cHost not foundUnknown erroral->refcount == 1host.cltgtampquotnbspch == '\'' || ch == 0x22html-parse.cch == quote_charhtml-parse.cch == '-'html-parse.cch == '-'html-parse.caappletareabasebgsoundbodyembedfigframeiframeimginputlayerlinkmetaoverlayscripttabletdthhrefcodehrefsrcbackgroundhrefsrcsrcsrcsrchreflowsrcsrcsrcsrcsrcsrcbackgroundbackgroundbackgroundrelhttp-equivnamecontent%s: no base, merge will use "%s". %s: Cannot resolve incomplete link %s. %s: link "%s" doesn't parse. %s: merge("%s", "%s") -> %s %s: merged link "%s" doesn't parse. appending "%s" to urlpos. first != -1html-url.chrefhrefrelstylesheetshortcut iconnamehttp-equivrefreshcontentrobotscontentnonenofollowtagid != -1html-url.c%s: %s Loaded %s (size %ld). no-follow in %s: %d HTTP/bytesnoneKeep-AliveInvalidating fd %d from further reuse. Closing fd %d pc_last_host_ip == NULLhttp.cpc_last_host_ip != NULLhttp.cRegistered fd %d for persistent reuse. Closing fd %d *hs->local_file != NULLhttp.cReusing connection to %s:%hu. Reusing fd %d. Referer: %s Range: bytes=%ld- Wget/%sAuthorizationProxy-Authorization:%d*/*%s %s HTTP/1.0 User-Agent: %s Host: %s%s Accept: %s %s%s%s%s%s%s%s%s ---request begin--- %s---request end--- Failed writing HTTP request: %s. Closing fd %d %s request sent, awaiting response... End of file while parsing headers. Closing fd %d Read error (%s) in headers. Closing fd %d No data receivedMalformed status line(no description) %2d %s%2d %s %2d %sContent-LengthContent-TypeLocationLast-ModifiedSet-CookieWWW-AuthenticateAccept-RangesContent-RangeKeep-AliveConnection inhibit_keep_alive == 0http.cClosing fd %d Authorization failed. Unknown authentication scheme. BasicLocation: %s%s unspecified [following]Closing fd %d text/htmltext/html.htm.html.html The file is already fully retrieved; nothing to do. Closing fd %d Continued download failed on this file, which conflicts with `-c'. Refusing to truncate existing file `%s'. Closing fd %d Closing fd %d Length: (%s to go)ignoredunspecified [%s] Closing fd %d %s: %s Closing fd %d Closing fd %d Closing fd %d Warning: wildcards not supported in HTTP. File `%s' already there, will not retrieve. htmlhtm.orig (try:%2d)--%s-- %s %s => `%s' Cannot write to `%s' (%s). Unable to establish SSL connection. ERROR: Redirection (%d) without location. %s: %s ERROR %d: %s. Last-modified header missing -- time-stamps turned off. Last-modified header invalid -- time-stamp ignored. Server file no newer than local file `%s' -- not retrieving. The sizes do not match (local %ld) -- retrieving. Remote file is newer, retrieving. %d %s %s (%s) - `%s' saved [%ld/%ld] %s URL:%s [%ld/%ld] -> "%s" [%d] %s (%s) - `%s' saved [%ld] %s URL:%s [%ld] -> "%s" [%d] %s (%s) - Connection closed at byte %ld. %s (%s) - `%s' saved [%ld/%ld]) %s URL:%s [%ld/%ld] -> "%s" [%d] %s (%s) - Connection closed at byte %ld/%ld. %s (%s) - Read error at byte %ld (%s).%s (%s) - Read error at byte %ld/%ld (%s). %a, %d %b %Y %T%A, %d-%b-%y %T%a, %d-%b-%Y %T%a %b %d %T %Y%s:%s%s: Basic %s realmopaquenonce:::::Authorization: Digest username="%s", realm="%s", nonce="%s", uri="%s", response="%s", opaque="" BasicDigestNTLMBasicAuthorizationNTLMAuthorizationDigest.anonymous-wget@no_proxyHOMEWGETRC%s: %s: %s. .wgetrc%s/.wgetrcrb%s: Cannot read %s (%s). %s: Error in %s at line %d. %s: Error in %s at line %d. /opt/csw/etc/wgetrc/opt/csw/etc/wgetrc/opt/csw/etc/wgetrc%s: Warning: Both system and user wgetrc point to `%s'. %s: BUG: unknown command `%s', value `%s'. %s: %s: Cannot convert `%s' to an IP address. onoff%s: %s: Please specify on or off. alwaysonoffnever%s: %s: Please specify always, on, off, or never. %s: %s: Invalid specification `%s'. inf%s: Invalid specification `%s' %s: Invalid specification `%s' %s: Invalid specification `%s' %s: Invalid specification `%s' %s: %s: Invalid specification `%s'. %s: %s: Invalid progress type `%s'. %s: %s: Invalid specification `%s'. wget-log %s received, redirecting output to `%s'. w%s: %s; disabling logging. wget/opt/csw/share/localewgetUsage: %s [OPTION]... [URL]... GNU Wget %s, a non-interactive network retriever. Mandatory arguments to long options are mandatory for short options too. Startup: -V, --version display the version of Wget and exit. -h, --help print this help. -b, --background go to background after startup. -e, --execute=COMMAND execute a `.wgetrc'-style command. Logging and input file: -o, --output-file=FILE log messages to FILE. -a, --append-output=FILE append messages to FILE. -d, --debug print debug output. -q, --quiet quiet (no output). -v, --verbose be verbose (this is the default). -nv, --non-verbose turn off verboseness, without being quiet. -i, --input-file=FILE download URLs found in FILE. -F, --force-html treat input file as HTML. -B, --base=URL prepends URL to relative links in -F -i file. --sslcertfile=FILE optional client certificate. --sslcertkey=KEYFILE optional keyfile for this certificate. --egd-file=FILE file name of the EGD socket. Download: --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). -O --output-document=FILE write documents to FILE. -nc, --no-clobber don't clobber existing files or use .# suffixes. -c, --continue resume getting a partially-downloaded file. --progress=TYPE select progress gauge type. -N, --timestamping don't re-retrieve files unless newer than local. -S, --server-response print server response. --spider don't download anything. -T, --timeout=SECONDS set the read timeout to SECONDS. -w, --wait=SECONDS wait SECONDS between retrievals. --waitretry=SECONDS wait 1...SECONDS between retries of a retrieval. --random-wait wait from 0...2*WAIT secs between retrievals. -Y, --proxy=on/off turn proxy on or off. -Q, --quota=NUMBER set retrieval quota to NUMBER. --limit-rate=RATE limit download rate to RATE. Directories: -nd --no-directories don't create directories. -x, --force-directories force creation of directories. -nH, --no-host-directories don't create host directories. -P, --directory-prefix=PREFIX save files to PREFIX/... --cut-dirs=NUMBER ignore NUMBER remote directory components. HTTP options: --http-user=USER set http user to USER. --http-passwd=PASS set http password to PASS. -C, --cache=on/off (dis)allow server-cached data (normally allowed). -E, --html-extension save all text/html documents with .html extension. --ignore-length ignore `Content-Length' header field. --header=STRING insert STRING among the headers. --proxy-user=USER set USER as proxy username. --proxy-passwd=PASS set PASS as proxy password. --referer=URL include `Referer: URL' header in HTTP request. -s, --save-headers save the HTTP headers to file. -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. --no-http-keep-alive disable HTTP keep-alive (persistent connections). --cookies=off don't use cookies. --load-cookies=FILE load cookies from FILE before session. --save-cookies=FILE save cookies to FILE after session. FTP options: -nr, --dont-remove-listing don't remove `.listing' files. -g, --glob=on/off turn file name globbing on or off. --passive-ftp use the "passive" transfer mode. --retr-symlinks when recursing, get linked-to files (not dirs). Recursive retrieval: -r, --recursive recursive web-suck -- use with care! -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). --delete-after delete files locally after downloading them. -k, --convert-links convert non-relative links to relative. -K, --backup-converted before converting file X, back up as X.orig. -m, --mirror shortcut option equivalent to -r -N -l inf -nr. -p, --page-requisites get all images, etc. needed to display HTML page. Recursive accept/reject: -A, --accept=LIST comma-separated list of accepted extensions. -R, --reject=LIST comma-separated list of rejected extensions. -D, --domains=LIST comma-separated list of accepted domains. --exclude-domains=LIST comma-separated list of rejected domains. --follow-ftp follow FTP links from HTML documents. --follow-tags=LIST comma-separated list of followed HTML tags. -G, --ignore-tags=LIST comma-separated list of ignored HTML tags. -H, --span-hosts go to foreign hosts when recursive. -L, --relative follow relative links only. -I, --include-directories=LIST list of allowed directories. -X, --exclude-directories=LIST list of excluded directories. -np, --no-parent don't ascend to the parent directory. Mail bug reports and suggestions to . spideronnoparentondeleteafteronretrsymlinksonignorelengthonpassiveftponnoclobberonfollowftponcutdirsverboseoffdirstructoffaddhostdiroffremovelistingoffbindaddresshttpkeepaliveoffrandomwaitonbackgroundoncontinueondebugonhtmlextensiononforcehtmlonspanhostsonbackupconvertedonconvertlinksonrelativeonlyonmirrorontimestampingonpagerequisitesonserverresponseonsaveheadersonquietonrecursiveonGNU Wget %s %sCopyright (C) 1995, 1996, 1997, 1998, 2000, 2001 Free Software Foundation, Inc. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. Originally written by Hrvoje Niksic . verboseondirstructonhttpuserhttppasswdheaderdotstylehtmlifyexcludedomainsproxyuserproxypasswdbackupswaitretryfollowtagscookiesloadcookiessavecookiesprogresslimitraterefereracceptlogfilebasecachedomains%s: %s: invalid command ignoretagsglobincludedirectoriesinputreclevelverboseoffaddhostdiroffdirstructoffnoclobberonremovelistingoffnoparentonhttpkeepaliveoff%s: illegal option -- `-n%c' Try `%s --help' for more options. outputdocumentlogfiledirprefixquotarejecttimeouttriesuseragentwaitexcludedirectoriesuseproxy Try `%s --help' for more options. Can't be verbose and quiet at the same time. Can't timestamp and not clobber old files at the same time. %s: missing URL Try `%s --help' for more options. DEBUG output created by Wget %s on %s. Removing file due to --delete-after in main(): Removing %s. unlink: %s No URLs found in %s. FINISHED --%s-- Downloaded: %s bytes in %d files Download quota (%s bytes) EXCEEDED! .netrc%s/%sr%s: Cannot read %s (%s). %s: %s:%d: warning: "%s" token appears before any machine name accountdefaultloginmacdefmachinepassword%s: %s:%d: unknown token "%s" bardot %*s[ skipping %dK ] %5ldK ,dp->dots < opt.dots_in_lineprogress.c%3d%% %s %5ldK . %5ldK defaultbinarymegagigaInvalid dot style specification `%s'; leaving unchanged. percentage <= 100progress.c%2d%% 100% dlsz <= progress_sizeprogress.c %-11s %7.2f%s --.--K/s ETA --:--%d:%02d:%02d%02d:%02d ETA --:--p - bp->buffer <= bp->widthprogress.c TERMforceemacsdotEnqueuing %s at depth %d Queue count %d, maxcount %d. Dequeuing %s at depth %d Queue count %d, maxcount %d. %s: %s. Already downloaded "%s", reusing it from "%s". Not descending further; at depth %d, max. %d. url_parsed != NULLrecur.cRemoving file due to %s in recursive_retrieve(): Removing %s. Removing %s since it should be rejected. unlink: %s Deciding whether to enqueue "%s". Already on the black list. Not following non-HTTP schemes. It doesn't really look like a relative link. The domain was not accepted. Going to "%s" would escape "%s" with no_parent on. %s (%s) is excluded/not-included. htmlhtm%s (%s) does not match acc/rej rules. This is not the same hostname as the parent's (%s and %s). Not following %s because robots.txt forbids it. Decided to load it. Decided NOT to load it. orig_parsed != NULLrecur.cnew_parsed != NULLrecur.cRedirection "%s" failed the test. /index.htmlfile != NULLrecur.cApparently %s has been removed. Scanning %s (from %s) will convert url %s to local %s will convert url %s to complete Converted %d files in %.2f seconds. wgetj == cntres.c!EOL (p)res.cIgnoring malformed line %duser-agentallowdisallowIgnoring unknown field at line %dCannot open %s: %s%s path %s because of rule `%s'. /robots.txtLoading robots.txt; please ignore errors. deferring a %ld ms sleep (%ld/%ld) until later. sleeping %ld ms msecs >= 0retr.cbytes >= 0retr.c%s: %s. Could not find proxy host. Error parsing proxy URL %s: %s. Error in proxy URL %s: Must be HTTP. htmlhtmmynewloc != NULLretr.c%s: %s. %d redirections exceeded. %s: Redirection cycle detected. Removing file due to --delete-after in retrieve_from_file(): Removing %s. unlink: %s Giving up. Retrying. sleep_between_retrievals: norm=%ld,fuzz=%ld,sleep=%d p2 - newstr == newlenurl.cp2 - newstr == newlenurl.c/?@ftp://%shttp://%s:/;?#/;?#;?#?##*p == 0url.cerror_code >= 0 && error_code < ARRAY_SIZE (parse_errors)url.c%s: %s Loaded %s (size %ld). %s: Invalid URL %s: %s %s.%d%s.%d%s.%dRemoving %s because of directory danger! %s: %s%s/%s%s%s%s%s%s%s?%s/%s?;#scheme_str != NULLurl.cp - result == sizeurl.chttp_proxyftp_proxyConverting %s... nothing to do. Cannot convert links in %s: %s Unable to delete `%s': %s wbCannot convert links in %s: %s Something strange is going on. Please investigate.Skipping %s at position %d. TO_RELATIVE: %s to %s at position %d in %s. TO_COMPLETE: to %s at position %d in %s. %d-%d *s1 != '/'url.c../orig.origCannot back up %s as %s: %s %d; URL=%sto - newname == fsqlenurl.c%s: %s: Not enough memory. mallocreallocstrdup%02d:%02d:%02d%04d-%02d-%02d %02d:%02d:%02dwget-logforkContinuing in background, pid %d. Output will be written to `%s'. /dev/nullr/dev/nullw/dev/nullwutime(%s): %s Unlinking %s (symlink). Failed to unlink symlink `%s': %s %s.%d®È00¿ÿó<0¿ÿðH0¿ÿíT0¿ÿê`0¿ÿçl0¿ÿäx0¿ÿá„0¿ÿÞ0¿ÿÛœ0¿ÿب0¿ÿÕ´0¿ÿÒÀ0¿ÿÏÌ0¿ÿÌØ0¿ÿÉä0¿ÿÆð0¿ÿÃü0¿ÿÀ0¿ÿ½0¿ÿº 0¿ÿ·,0¿ÿ´80¿ÿ±D0¿ÿ®P0¿ÿ«\0¿ÿ¨h0¿ÿ¥t0¿ÿ¢€0¿ÿŸŒ0¿ÿœ˜0¿ÿ™¤0¿ÿ–°0¿ÿ“¼0¿ÿÈ0¿ÿÔ0¿ÿŠà0¿ÿ‡ì0¿ÿ„ø0¿ÿ0¿ÿ~0¿ÿ{0¿ÿx(0¿ÿu40¿ÿr@0¿ÿoL0¿ÿlX0¿ÿid0¿ÿfp0¿ÿc|0¿ÿ`ˆ0¿ÿ]”0¿ÿZ 0¿ÿW¬0¿ÿT¸0¿ÿQÄ0¿ÿNÐ0¿ÿKÜ0¿ÿHè0¿ÿEô0¿ÿB0¿ÿ? 0¿ÿ<0¿ÿ9$0¿ÿ600¿ÿ3<0¿ÿ0H0¿ÿ-T0¿ÿ*`0¿ÿ'l0¿ÿ$x0¿ÿ!„0¿ÿ0¿ÿœ0¿ÿ¨0¿ÿ´0¿ÿÀ0¿ÿÌ0¿ÿ Ø0¿ÿ ä0¿ÿð0¿ÿü0¿ÿ0¿þý0¿þú 0¿þ÷,0¿þô80¿þñD0¿þîP0¿þë\0¿þèh0¿þåt0¿þâ€0¿þߌ0¿þܘ0¿þÙ¤0¿þÖ°0¿þÓ¼0¿þÐÈ0¿þÍÔ0¿þÊà0¿þÇì0¿þÄø0¿þÁ0¿þ¾0¿þ»0¿þ¸(0¿þµ40¿þ²@0¿þ¯L0¿þ¬X0¿þ©d0¿þ¦p0¿þ£‘¬¸ Cø DHÂÂè# à \ oÿýøÆoÿÿþ4üoÿÿÿL5ø5Œ¸ oÿýüoÿÿû©Hÿü‹ÿþ•ÿþ”@ÿþ•®¸ÿÿÿÿÜܘÜ ܨÜ°ܸÜÀahatb b$b(b,b0b4b8b<b@bDbHbLdPdTdXd\d`dddhdldpdtdxd|ÝÝÝÝ Ý$Ý(Ý,Ý0Ý4Ý8Ý<Ý@AABEACEACTADADAADDAGOAIDAIMAIRALLALPAMAMYANANAANDANNANTANYAPEAPSAPTARCAREARKARMARTASASHASKATATEAUGAUKAVEAWEAWKAWLAWNAXAYEBADBAGBAHBAMBANBARBATBAYBEBEDBEEBEGBENBETBEYBIBBIDBIGBINBITBOBBOGBONBOOBOPBOWBOYBUBBUDBUGBUMBUNBUSBUTBUYBYBYECABCALCAMCANCAPCARCATCAWCODCOGCOLCONCOOCOPCOTCOWCOYCRYCUBCUECUPCURCUTDABDADDAMDANDARDAYDEEDELDENDESDEWDIDDIEDIGDINDIPDODOEDOGDONDOTDOWDRYDUBDUDDUEDUGDUNEAREATEDEELEGGEGOELIELKELMELYEMENDESTETCEVAEVEEWEEYEFADFANFARFATFAYFEDFEEFEWFIBFIGFINFIRFITFLOFLYFOEFOGFORFRYFUMFUNFURGABGADGAGGALGAMGAPGASGAYGEEGELGEMGETGIGGILGINGOGOTGUMGUNGUSGUTGUYGYMGYPHAHADHALHAMHANHAPHASHATHAWHAYHEHEMHENHERHEWHEYHIHIDHIMHIPHISHITHOHOBHOCHOEHOGHOPHOTHOWHUBHUEHUGHUHHUMHUTIICYIDAIFIKEILLINKINNIOIONIQIRAIREIRKISITITSIVYJABJAGJAMJANJARJAWJAYJETJIGJIMJOJOBJOEJOGJOTJOYJUGJUTKAYKEGKENKEYKIDKIMKINKITLALABLACLADLAGLAMLAPLAWLAYLEALEDLEELEGLENLEOLETLEWLIDLIELINLIPLITLOLOBLOGLOPLOSLOTLOULOWLOYLUGLYEMAMACMADMAEMANMAOMAPMATMAWMAYMEMEGMELMENMETMEWMIDMINMITMOBMODMOEMOOMOPMOSMOTMOWMUDMUGMUMMYNABNAGNANNAPNATNAYNENEDNEENETNEWNIBNILNIPNITNONOBNODNONNORNOTNOVNOWNUNUNNUTOOAFOAKOAROATODDODEOFOFFOFTOHOILOKOLDONONEORORBOREORROSOTTOUROUTOVAOWOWEOWLOWNOXPAPADPALPAMPANPAPPARPATPAWPAYPEAPEGPENPEPPERPETPEWPHIPIPIEPINPITPLYPOPODPOEPOPPOTPOWPROPRYPUBPUGPUNPUPPUTQUORAGRAMRANRAPRATRAWRAYREBREDREPRETRIBRIDRIGRIMRIORIPROBRODROERONROTROWROYRUBRUERUGRUMRUNRYESACSADSAGSALSAMSANSAPSATSAWSAYSEASECSEESENSETSEWSHESHYSINSIPSIRSISSITSKISKYSLYSOSOBSODSONSOPSOWSOYSPASPYSUBSUDSUESUMSUNSUPTABTADTAGTANTAPTARTEATEDTEETENTHETHYTICTIETIMTINTIPTOTOETOGTOMTONTOOTOPTOWTOYTRYTUBTUGTUMTUNTWOUNUPUSUSEVANVATVETVIEWADWAGWARWASWAYWEWEBWEDWEEWETWHOWHYWINWITWOKWONWOOWOWWRYWUYAMYAPYAWYEYEAYESYETYOUABEDABELABETABLEABUTACHEACIDACMEACREACTAACTSADAMADDSADENAFARAFROAGEEAHEMAHOYAIDAAIDEAIDSAIRYAJARAKINALANALECALGAALIAALLYALMAALOEALSOALTOALUMALVAAMENAMESAMIDAMMOAMOKAMOSAMRAANDYANEWANNAANNEANTEANTIAQUAARABARCHAREAARGOARIDARMYARTSARTYASIAASKSATOMAUNTAURAAUTOAVERAVIDAVISAVONAVOWAWAYAWRYBABEBABYBACHBACKBADEBAILBAITBAKEBALDBALEBALIBALKBALLBALMBANDBANEBANGBANKBARBBARDBAREBARKBARNBARRBASEBASHBASKBASSBATEBATHBAWDBAWLBEADBEAKBEAMBEANBEARBEATBEAUBECKBEEFBEENBEERBEETBELABELLBELTBENDBENTBERGBERNBERTBESSBESTBETABETHBHOYBIASBIDEBIENBILEBILKBILLBINDBINGBIRDBITEBITSBLABBLATBLEDBLEWBLOBBLOCBLOTBLOWBLUEBLUMBLURBOARBOATBOCABOCKBODEBODYBOGYBOHRBOILBOLDBOLOBOLTBOMBBONABONDBONEBONGBONNBONYBOOKBOOMBOONBOOTBOREBORGBORNBOSEBOSSBOTHBOUTBOWLBOYDBRADBRAEBRAGBRANBRAYBREDBREWBRIGBRIMBROWBUCKBUDDBUFFBULBBULKBULLBUNKBUNTBUOYBURGBURLBURNBURRBURTBURYBUSHBUSSBUSTBUSYBYTECADYCAFECAGECAINCAKECALFCALLCALMCAMECANECANTCARDCARECARLCARRCARTCASECASHCASKCASTCAVECEILCELLCENTCERNCHADCHARCHATCHAWCHEFCHENCHEWCHICCHINCHOUCHOWCHUBCHUGCHUMCITECITYCLADCLAMCLANCLAWCLAYCLODCLOGCLOTCLUBCLUECOALCOATCOCACOCKCOCOCODACODECODYCOEDCOILCOINCOKECOLACOLDCOLTCOMACOMBCOMECOOKCOOLCOONCOOTCORDCORECORKCORNCOSTCOVECOWLCRABCRAGCRAMCRAYCREWCRIBCROWCRUDCUBACUBECUFFCULLCULTCUNYCURBCURDCURECURLCURTCUTSDADEDALEDAMEDANADANEDANGDANKDAREDARKDARNDARTDASHDATADATEDAVEDAVYDAWNDAYSDEADDEAFDEALDEANDEARDEBTDECKDEEDDEEMDEERDEFTDEFYDELLDENTDENYDESKDIALDICEDIEDDIETDIMEDINEDINGDINTDIREDIRTDISCDISHDISKDIVEDOCKDOESDOLEDOLLDOLTDOMEDONEDOOMDOORDORADOSEDOTEDOUGDOURDOVEDOWNDRABDRAGDRAMDRAWDREWDRUBDRUGDRUMDUALDUCKDUCTDUELDUETDUKEDULLDUMBDUNEDUNKDUSKDUSTDUTYEACHEARLEARNEASEEASTEASYEBENECHOEDDYEDENEDGEEDGYEDITEDNAEGANELANELBAELLAELSEEMILEMITEMMAENDSERICEROSEVENEVEREVILEYEDFACEFACTFADEFAILFAINFAIRFAKEFALLFAMEFANGFARMFASTFATEFAWNFEARFEATFEEDFEELFEETFELLFELTFENDFERNFESTFEUDFIEFFIGSFILEFILLFILMFINDFINEFINKFIREFIRMFISHFISKFISTFITSFIVEFLAGFLAKFLAMFLATFLAWFLEAFLEDFLEWFLITFLOCFLOGFLOWFLUBFLUEFOALFOAMFOGYFOILFOLDFOLKFONDFONTFOODFOOLFOOTFORDFOREFORKFORMFORTFOSSFOULFOURFOWLFRAUFRAYFREDFREEFRETFREYFROGFROMFUELFULLFUMEFUNDFUNKFURYFUSEFUSSGAFFGAGEGAILGAINGAITGALAGALEGALLGALTGAMEGANGGARBGARYGASHGATEGAULGAURGAVEGAWKGEARGELDGENEGENTGERMGETSGIBEGIFTGILDGILLGILTGINAGIRDGIRLGISTGIVEGLADGLEEGLENGLIBGLOBGLOMGLOWGLUEGLUMGLUTGOADGOALGOATGOERGOESGOLDGOLFGONEGONGGOODGOOFGOREGORYGOSHGOUTGOWNGRABGRADGRAYGREGGREWGREYGRIDGRIMGRINGRITGROWGRUBGULFGULLGUNKGURUGUSHGUSTGWENGWYNHAAGHAASHACKHAILHAIRHALEHALFHALLHALOHALTHANDHANGHANKHANSHARDHARKHARMHARTHASHHASTHATEHATHHAULHAVEHAWKHAYSHEADHEALHEARHEATHEBEHECKHEEDHEELHEFTHELDHELLHELMHERBHERDHEREHEROHERSHESSHEWNHICKHIDEHIGHHIKEHILLHILTHINDHINTHIREHISSHIVEHOBOHOCKHOFFHOLDHOLEHOLMHOLTHOMEHONEHONKHOODHOOFHOOKHOOTHORNHOSEHOSTHOURHOVEHOWEHOWLHOYTHUCKHUEDHUFFHUGEHUGHHUGOHULKHULLHUNKHUNTHURDHURLHURTHUSHHYDEHYMNIBISICONIDEAIDLEIFFYINCAINCHINTOIONSIOTAIOWAIRISIRMAIRONISLEITCHITEMIVANJACKJADEJAILJAKEJANEJAVAJEANJEFFJERKJESSJESTJIBEJILLJILTJIVEJOANJOBSJOCKJOELJOEYJOHNJOINJOKEJOLTJOVEJUDDJUDEJUDOJUDYJUJUJUKEJULYJUNEJUNKJUNOJURYJUSTJUTEKAHNKALEKANEKANTKARLKATEKEELKEENKENOKENTKERNKERRKEYSKICKKILLKINDKINGKIRKKISSKITEKLANKNEEKNEWKNITKNOBKNOTKNOWKOCHKONGKUDOKURDKURTKYLELACELACKLACYLADYLAIDLAINLAIRLAKELAMBLAMELANDLANELANGLARDLARKLASSLASTLATELAUDLAVALAWNLAWSLAYSLEADLEAFLEAKLEANLEARLEEKLEERLEFTLENDLENSLENTLEONLESKLESSLESTLETSLIARLICELICKLIEDLIENLIESLIEULIFELIFTLIKELILALILTLILYLIMALIMBLIMELINDLINELINKLINTLIONLISALISTLIVELOADLOAFLOAMLOANLOCKLOFTLOGELOISLOLALONELONGLOOKLOONLOOTLORDLORELOSELOSSLOSTLOUDLOVELOWELUCKLUCYLUGELUKELULULUNDLUNGLURALURELURKLUSHLUSTLYLELYNNLYONLYRAMACEMADEMAGIMAIDMAILMAINMAKEMALEMALIMALLMALTMANAMANNMANYMARCMAREMARKMARSMARTMARYMASHMASKMASSMASTMATEMATHMAULMAYOMEADMEALMEANMEATMEEKMEETMELDMELTMEMOMENDMENUMERTMESHMESSMICEMIKEMILDMILEMILKMILLMILTMIMIMINDMINEMINIMINKMINTMIREMISSMISTMITEMITTMOANMOATMOCKMODEMOLDMOLEMOLLMOLTMONAMONKMONTMOODMOONMOORMOOTMOREMORNMORTMOSSMOSTMOTHMOVEMUCHMUCKMUDDMUFFMULEMULLMURKMUSHMUSTMUTEMUTTMYRAMYTHNAGYNAILNAIRNAMENARYNASHNAVENAVYNEALNEARNEATNECKNEEDNEILNELLNEONNERONESSNESTNEWSNEWTNIBSNICENICKNILENINANINENOAHNODENOELNOLLNONENOOKNOONNORMNOSENOTENOUNNOVANUDENULLNUMBOATHOBEYOBOEODINOHIOOILYOINTOKAYOLAFOLDYOLGAOLINOMANOMENOMITONCEONESONLYONTOONUSORALORGYOSLOOTISOTTOOUCHOUSTOUTSOVALOVENOVEROWLYOWNSQUADQUITQUODRACERACKRACYRAFTRAGERAIDRAILRAINRAKERANKRANTRARERASHRATERAVERAYSREADREALREAMREARRECKREEDREEFREEKREELREIDREINRENARENDRENTRESTRICERICHRICKRIDERIFTRILLRIMERINGRINKRISERISKRITEROADROAMROARROBEROCKRODEROILROLLROMEROODROOFROOKROOMROOTROSAROSEROSSROSYROTHROUTROVEROWEROWSRUBERUBYRUDERUDYRUINRULERUNGRUNSRUNTRUSERUSHRUSKRUSSRUSTRUTHSACKSAFESAGESAIDSAILSALESALKSALTSAMESANDSANESANGSANKSARASAULSAVESAYSSCANSCARSCATSCOTSEALSEAMSEARSEATSEEDSEEKSEEMSEENSEESSELFSELLSENDSENTSETSSEWNSHAGSHAMSHAWSHAYSHEDSHIMSHINSHODSHOESHOTSHOWSHUNSHUTSICKSIDESIFTSIGHSIGNSILKSILLSILOSILTSINESINGSINKSIRESITESITSSITUSKATSKEWSKIDSKIMSKINSKITSLABSLAMSLATSLAYSLEDSLEWSLIDSLIMSLITSLOBSLOGSLOTSLOWSLUGSLUMSLURSMOGSMUGSNAGSNOBSNOWSNUBSNUGSOAKSOARSOCKSODASOFASOFTSOILSOLDSOMESONGSOONSOOTSORESORTSOULSOURSOWNSTABSTAGSTANSTARSTAYSTEMSTEWSTIRSTOWSTUBSTUNSUCHSUDSSUITSULKSUMSSUNGSUNKSURESURFSWABSWAGSWAMSWANSWATSWAYSWIMSWUMTACKTACTTAILTAKETALETALKTALLTANKTASKTATETAUTTEALTEAMTEARTECHTEEMTEENTEETTELLTENDTENTTERMTERNTESSTESTTHANTHATTHEETHEMTHENTHEYTHINTHISTHUDTHUGTICKTIDETIDYTIEDTIERTILETILLTILTTIMETINATINETINTTINYTIRETOADTOGOTOILTOLDTOLLTONETONGTONYTOOKTOOLTOOTTORETORNTOTETOURTOUTTOWNTRAGTRAMTRAYTREETREKTRIGTRIMTRIOTRODTROTTROYTRUETUBATUBETUCKTUFTTUNATUNETUNGTURFTURNTUSKTWIGTWINTWITULANUNITURGEUSEDUSERUSESUTAHVAILVAINVALEVARYVASEVASTVEALVEDAVEILVEINVENDVENTVERBVERYVETOVICEVIEWVINEVISEVOIDVOLTVOTEWACKWADEWAGEWAILWAITWAKEWALEWALKWALLWALTWANDWANEWANGWANTWARDWARMWARNWARTWASHWASTWATSWATTWAVEWAVYWAYSWEAKWEALWEANWEARWEEDWEEKWEIRWELDWELLWELTWENTWEREWERTWESTWHAMWHATWHEEWHENWHETWHOAWHOMWICKWIFEWILDWILLWINDWINEWINGWINKWINOWIREWISEWISHWITHWOLFWONTWOODWOOLWORDWOREWORKWORMWORNWOVEWRITWYNNYALEYANGYANKYARDYARNYAWLYAWNYEAHYEARYELLYOGAYOKE?k¤k”¤kœ¤k¤k¬¤k´¤k¼¤kĤkȤkФkؤkܤkä¤kì¸kô\kü¤l¤l ¤l¤l¤ll$l,l4l8lDlLlPlT lX l\ ld ll lp ltlxl|l€lŒl˜l¤l¨l´l¼x(x8xHxXABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/x€èxˆèxè ÝÐ$lxÝØhdÝäXhdÝðÜhdÝüèhdÞ ìjÞ˜kÞ g¬Þ(„hdÞ0XhdÞ<øhdÞL$hdÞTjÞ\àhdÞdhdÞpkHÞ|pìÞˆ4lxÞm|Þœ jÞ¨jÞ´kÞÀ,lÀÞÔ8lxÞäDhdÞð<lxÞühdߌkßhhdßq<ß$hdß4r@ß<|hdßLtkßXˆkßdkßppkß|ähdߌ@lxߘ0lÀ߬kHß´àhdßÀ¼m|ßÌ(kHßØkHßà\kßèrˆßðdhdßø hdàôhdà”lxàØjäà$LkHà4hdàDliàP`kàXœsàd¤kàp kà|Ôhdà„Àm|àŒ¬hdà˜øjäà¤s|à°ôkà¸(lxàÀðhdàÐühdààHhdàð¸hdàø,kHáÜhdáØhdá ìhdá, hdá4¨o(á<ähdáLØjäáT€hdá`sØálÐhdát°o(á|´o(ÿÿÿÿábáœKá°cá¼káÌdáÔˆáä•áøŽâxâxâ$Fâ0hâ8EâHŠâXmâ`âl“â|”â–⠜ⴅâÀ’âÌ‹âØpâèqâð¥âürãLã‰ã$sã4SãDHãP„ãXNãhvãpVãxAã€aã—ã˜Bã ›ã°C㸠ãÀ‘ãÌPãàDãè†ãôeãüXäŒä ™ä,gä4ƒä<‡äD‚äPä\GähIä|iäˆlä¤äœ¡ä¬nä°OäÀoäÌ£äØYäàäðäüQåRå ¢åTå$tå,Uå8å@YåLwåT˜æL¢¤$¥¬§0æP¨˜©©ì°ÀPæXæ\æ`ædæ°æ´æ¼æÄæàPæèÿÿÿÿæðæüççç,ç|permanentnonpermanent.com.edu.net.org.gov.mil.intTRUEFALSETRUEFALSE/.abwb :JanFebMarAprMayJunJulAugSepOctNovDec(nil)HEADGETPragma: no-cache Connection: Keep-Alive */*ProxyHTTPabwbacceptaddhostdiralwaysrestbackgroundbackupconvertedbackupsbasebindaddresscachecontinueconvertlinkscookiescutdirsdebugdeleteafterdirprefixdirstructdomainsdotbytesdotsinlinedotspacingdotstyleexcludedirectoriesexcludedomainsfollowftpfollowtagsforcehtmlftpproxyglobheaderhtmlextensionhtmlifyhttpkeepalivehttppasswdhttpproxyhttpsproxyhttpuserignorelengthignoretagsincludedirectoriesinputkilllongerlimitrateloadcookieslogfileloginmirrornetrcnoclobbernoparentnoproxynumtriesoutputdocumentpagerequisitespassiveftppasswdprogressproxypasswdproxyuserquietquotarandomwaitreclevelrecursiverefererrejectrelativeonlyremovelistingretrsymlinksrobotssavecookiessaveheadersserverresponsespanhostsspidertimeouttimestampingtriesuseproxyuseragentverbosewaitwaitretryawbackgroundbackup-convertedcontinueconvert-linksdebugdelete-afterdont-remove-listingfollow-ftpforce-directoriesforce-hierforce-htmlhelphtml-extensionignore-lengthmirrorno-clobberno-directoriesno-host-directoriesno-host-lookupno-http-keep-aliveno-parentnon-verbosepassive-ftppage-requisitesquietrandom-waitrecursiverelativeretr-symlinkssave-headersserver-responsespan-hostsspidertimestampingverboseversionacceptappend-outputbackupsbasebind-addresscachecookiescut-dirsdirectory-prefixdomainsdot-styleexecuteexclude-directoriesexclude-domainsfollow-tagsglobheaderhtmlifyhttp-passwdhttp-userignore-tagsinclude-directoriesinput-filelevellimit-rateload-cookiesnooutput-documentoutput-fileprogressproxyproxy-passwdproxy-userquotarejectsave-cookiestimeouttriesuser-agentrefereruse-proxywaitwaitretryhpVqvdkKsxmNWrHSLcFbEY:G:g:T:U:O:l:n:i:o:a:t:D:A:R:P:B:e:Q:X:I:w:C:hpVqvdkKsxmNWrHSLcFbEY:G:g:T:U:O:l:n:i:o:a:t:D:A:R:P:B:e:Q:X:I:w:C:solaris2.8abwbSIGHUPSIGUSR1WTF?!.netrcloginpasswordmacdefaccountdotbarB/sK/sM/sG/s--delete-afterrecursive rejection criteriaAllowingRejectingB/sKB/sMB/sGB/s%7.2f %s%.2f %shttp://ftp://No errorUnsupported schemeEmpty hostBad port numberInvalid user name/index.html/index.html*password*11.8.2cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)limits.h 1.51 99/10/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)socket.h 1.54 01/03/12 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)in.h 1.31 00/10/28 SMI@(#)stream.h 1.86 00/10/23 SMI@(#)vnode.h 1.85 99/07/30 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)param.h 1.76 00/02/14 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.20 97/09/22 SMI@(#)strft.h 1.2 00/10/23 SMI@(#)byteorder.h 1.14 98/04/19 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)netdb.h 1.25 01/05/08 SMI@(#)inet.h 1.18 01/01/16 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)socket.h 1.54 01/03/12 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)in.h 1.31 00/10/28 SMI@(#)stream.h 1.86 00/10/23 SMI@(#)vnode.h 1.85 99/07/30 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.20 97/09/22 SMI@(#)strft.h 1.2 00/10/23 SMI@(#)byteorder.h 1.14 98/04/19 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/16 SMI@(#)netdb.h 1.25 01/05/08 SMI@(#)utsname.h 1.26 98/12/03 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)socket.h 1.54 01/03/12 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)in.h 1.31 00/10/28 SMI@(#)stream.h 1.86 00/10/23 SMI@(#)vnode.h 1.85 99/07/30 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)param.h 1.76 00/02/14 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.20 97/09/22 SMI@(#)strft.h 1.2 00/10/23 SMI@(#)byteorder.h 1.14 98/04/19 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/16 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)signal.h 1.38 99/08/10 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal.h 1.54 99/07/26 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)md5.h 1.1 99/07/02 SMI@(#)md5.h 1.5 99/07/05 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)signal.h 1.38 99/08/10 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal.h 1.54 99/07/26 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)mman.h 1.38 99/05/19 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)limits.h 1.51 99/10/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)termios.h 1.6 92/07/14 SMI@(#)termios.h 1.38 98/02/20 SMI@(#)ttydev.h 1.7 92/07/14 SMI@(#)libintl.h 1.12 97/08/20 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11acomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11ld: Software Generation Utilities - Solaris Link Editors: 5.8-1.273.interp.hash.dynsym.dynstr.SUNW_version.rela.ex_shared.rela.cpp_finidata.rela.data.rela.bss.rela.plt.text.init.fini.exception_ranges.rodata.rodata1.got.plt.dynamic.ex_shared.cpp_finidata.data.data1.bss.symtab.strtab.stab.index.comment.shstrtab.stab.indexstrÔÔ èè t  \ \À"##àoÿÿþ4ü4ü-B5Œ5Œ0 =B5¼5¼  PB5È5È  [B5Ô5Ô$ eB5ø5øL o;H;H°uCøCøP{DHDH€DÈDÈ“DÌDÌ ›JìJì^V¤©D©D©©H©H€ ®®È®Èà·¯¨¯¨(¯ЯРЯà¯à,”ÖÜtÜt Ýçˆçˆ6þç‚€Ä hF 0707010020a358000081a4000027130000271000000001502b7c5e000282e0000000c300000fc500000000000000000000002700000000root/opt/csw/libexec/pkgutil/wget-i386ELF¨=4H4 (44  Ô^E^E`E`E\/˜h(G(GÐ/usr/lib/ld.so.1a_  #%()*+-/1345678:;<>@ABDEFGHIJLOPQSTUWXYZ\^_`bdfhklnoprstvwxz{~‚ƒ„†ˆ‹Ž‘’“•—˜šœŸ¢£¤¥§©ª«¬­®¯±³µ¶·¸»¼½¾¿ÀÁÄÅÆÇÊËÌÍÐÑÓÔ×ÙÛÜÝßàáãæçèëìîïóôõøùúüýþÿ    !"$&')+,./03678:;=?ABCDGIJLOPRSTVXY[] !"$&',.029=?CKMNRV[]acegijmquy|}€…‡‰ŠŒ”–™›ž ¡¦¨°²´¹ºÂÃÈÉÎÏÒÕÖØÚÞâäåéêíðñòö÷û  #%(*-12459<>@EFHKMNQUWZ\^x8 ðD{ Øf (ìf :ÌÖ OȢΠX”œ5 bªxx;LÒ‚ ‹(;“8À ¡è<©¤t¸° ë Æ0„& Óx=Ù¬—á ïxŠ: ÿdÊ 7àX¬ 5 Q D ªM(É@ \ô½j i̼Ì sX8xt¼ ƒ°Øn ‘<áë Ÿ8=¤È:«„– º }  Äô±â ÒÄ»F àÌ# ó”»/ ”’( ø89äÎQ -Ü @DÏ R¥ÿ ZTÀ< o<Ë! { +‘ †§B —`Í€ «H;²h=¿PÔ Åø:Ïœ¢Q Ûx<ãX= øl6 ”~a X9ÐÎœ -xDw 8œB™ =äb9 M@¨€_;i¤Î wäÉ ‹èh’(<š¦þ £à: °gW ºH:ÁØ9ÈX:Ï ñ2 àè9å Ù¶ î`º þôÄC àe2 tÇ; $˜7,äY <œ8 DàhK@Áž Zaw g¸:n ¿– z¤ÐV ‰4Ñ “ A6 œÈÑ º8;Áà‡ü Î|ÈV Ûoìø7øy 9h8ÔQ\ $,As 5p– Ip=} S”˜q `H8f ¼/ sŒÐc (:‰Ø8Žô­™üf ­ Ô# ³ìhº¸9Á¨;Ë\½ Ö`Ú9 ã,Ô ñ˜=öÈ7ýL¶ è;%<,h;3T‚ EØ;Od®G Y¨E‚ _Ø:f`Ë m¤Ëv |Œ×$ ˆ\Ì ™Ô! §8Â% ¿$ªÉH<Ò´@x â(-s 錀} ø˜8à8 À[Ô x{ (¬®ˆ 3´†Û =\ž@ K™“ U,ÕA m¤f É =–g ê8ðÈ<õT¿K ûLÑ  ? + ÄV 6ı/ EØC  OH=T˜<[ð¢ã jf( ƒðÐC (Ë$ •ˆ7š,Ñ  ¥„Î °Ô ÈX;Ñ:Ú€;‰ âh<è>" ð8Ū ¸; ø6 X< ì& " غ® , 4±Ž 5 øï( C lÖ^ X ¸8^ ø9e Ø<l ŒY ‡ è8Ž œŸÂ — PžK   è>S ¹ (ªÁ üÐ  Ò Ô£ö Ü ¼Q ë x:ò Ø7ý ˆ< ¼Ÿ8  èÔB ( »9 > x9F (T  [ ¨:d ˆ=j ˜½Z s `E‰ ´+s ” lXr ´ 4wÝ Æ ˜:Ì ¨<Ô @Ô' Ý èÑJ è ` Î ð ¨8÷  H>|  È9" ¸f  2 887 °Ç= @ œ–0 O h•| X ð=W h ,F’ o (=u Ñ$ ; ˜;˜ pÎ ¨ €Ô µ ŒQ  ÀÃ` É @Ì Ø lE< à °¨ í ¸Î+ ú h: h9 ¨=o  €Q  # ÜË/ 5 ÔÈ3 C tv U ^E \ 0ªÀ!a Z q (8x |[ ƒ è6"Œ X†[ – à; £ \i) ± 4–9 À è:È  ÉA × Äg ä h7ì Á) ø Xi  ø; $ X7+ => 9 ˜£j B ”¼8 N 89T ø­Y è7_ HÐC v ˆ8~ ÀÌž ’ 8Ï  ¥ ª!­ Ðva » ð­Á Ã, Ê „Ÿ8 Ö H7Ü €uº ñ `¾ò ðÇ‹ ø¡Î tgN #7-ˆ(G 6œYG FÈ;M4Óh \ähcØÙ? k˜9q8xÀ¨\|Ê( Œ ƒ9 ˜ c¿  :¦H9­¸<´0¡Æ ½=Ĩ9˘@) çØz õ(& þø<¬Ô9 Ø6 40ªÀ:X2 Pˆ;W¨7](Gf Ë y(9€<¼5 ŽX=•x7œàÁy §äšB ±¸7ºÈ8ÅhÉ6 ÐœÓj æd•w ñLÄî ôŸ» ˆ:¼t<xÐ* .ˆ958<?8:GÜ•W localtimecloseportrbuf_initialized_prbuf_uninitializepretty_print_addressftp_listurl_errorglobal_download_countgetpwuid__umoddi3strrchrfile_exists_pfreopenversion_stringget_urls_fileget_contentsioctlrewrite_shorthand_urlftp_get_listingfree_keys_and_valuesexitset_progress_implementationgen_md5_update_environslist_containsdatetime_strsepstringfreecount_characcept_domainmap_html_tagsopengetenvscheme_disablehttp_loopconvert_linksxrealloc_realhash_table_destroyxmalloc_realencode_stringstrncmpmemmovewtimer_elapsedretrieve_from_filehtml_quote_stringftp_pwdfile_non_directory_pgetopt_longinitializeftp_process_typehash_table_containsgmtimegettimeofday_finiinet_ntoafree_urlposstrpbrklog_set_save_contextprintwhatres_parse_from_filefprintfhash_table_putacceptportmaincookies_cleanupftp_last_resplineinet_addrwtimer_deletestring_set_containsopterrMD5Initftp_size_sch_tolowerrbuf_peekstrtokfflushstrtolcleanup_html_urlstatsufmatchdownloaded_filesuffixhas_wildcards_pread_file_freeconnectprogress_updatecleanupoptargmake_directorysave_cookiesstrcatremove_linkhash_table_map__udivdi3bindportmake_nocase_string_hash_tablefwriteretrieve_urlslist_appendredirect_requestgetsocknamerecursive_cleanupqsortmemcpysearch_netrctest_socket_openscheme_default_portlogprintfftp_responsewritexstrdup_realrandom_numbersymlinktimenetrc_listrbuf_read_bufferful_initoptoptfilenovsnprintfacceptablehost_cleanupheader_existsrandselectsleep_between_retrievalsbindtextdomainsignalgetuidres_retrieve_filesetlocaleuri_mergeireadmemsetgetopthash_table_newlookup_hostnumber_to_stringheader_strdupcalculate_skey_responseexec_nameMD5Finalconnect_to_manysetvalres_match_pathstrncasecmp_sch_istableload_cookiesres_parseurl_stringcalc_rateurl_full_pathurl_parseaddress_list_set_faultydownloaded_increaseslist_nreversemkdirconnect_to_oneread_filehash_table_removelogflushftp_parse_lsnumdigitlog_closentohsforktouchmake_string_hash_tabledownloaded_exceeds_quotamatch_tailno_proxy_matchselect_fdmmapmallocrotate_backupsprogress_handle_sigwinch__eprintflegiblebindstring_cmpwtimer_newaddress_list_get_boundsstrptimereadlinklogputssleep_mcountread_whole_lineperroratexitusleephttp_cleanupftp_indexgetproxyget_urls_htmladdress_list_releaseabortunlinksetsidprogress_schedule_redirectstrchrftp_typeftp_pasvset_connection_host_nameh_errnohash_table_countmkalldirsgen_md5_finishmktimesetsockoptrenameurl_set_fileaddress_list_match_alldownloaded_files_freesprintfset_cookie_header_cb__flsbufsrandtime_str_GLOBAL_OFFSET_TABLE_parse_linevalid_progress_implementation_pconvert_all_linksfgetcreallocskip_lwsheader_getftp_cwdsscanf__deregister_frame_infolog_initftruncaterbuf_initializereadfree_vecurl_skip_unameftp_loopdebug_logprintfiwritefgetsstring_hashgethostbynamevfprintfwtimer_allocate_lib_versiongen_md5_initaccdirhash_table_getconaddrurl_filenamewtimer_resetstrstrfputs_startgen_md5_context_sizelegible_very_longslist_prependregister_download_etext_iobprogress_finishaccepthttp_atotm_cleanupretr_rate_sch_toupperretrieve_treeurl_has_scheme_nunamestring_set_addrbuf_discardgettextunique_namefree_netrctextdomain__register_frame_infostrcmplog_set_flushftp_syststrdupdelimfopen_endhtonldetermine_screen_widthasctimehash_table_get_pairwtimer_granularityenvironregister_htmlerrnofrontcmpurl_set_dirhtonsregister_redirectionfork_to_backgroundmerge_vecsftp_retrrbuf_flush__fpstarthome_dirprogress_createisattyheader_processoptindherrmsgchmodlistenoptstring_set_freeres_cleanupfnmatchlstatfclosestrdupftp_restaccessrewindlog_request_redirect_outputres_get_specsftp_portutimeaddress_list_copy_one_PROCEDURE_LINKAGE_TABLE___iobbuild_cookies_requestprintfclose_DYNAMICres_register_specsmemchrxstrdup_lowermunmapsocketfile_mergeftp_loginstrerrorstrcasecmpslist_freeheader_extract_numberurl_scheme_getopt_internalurl_freeatoi_edatafstathash_table_clearstrcpyMD5Updatestrncpyurl_skip_schemelibmd5.so.1SUNW_1.1libsocket.so.1SUNW_0.7libnsl.so.1SUNW_0.7libc.so.1SUNW_1.1libmd5.so.1libsocket.so.1libnsl.so.1libc.so.1W ‘'= cl —(= {„ —(= ™‘'= £|Eæ„E$GD(ªÍ ªð­"0ªDlEpE¾tE+xE€EæˆEŒE%E”E˜EMœE³ EU¤EG¨EP¬E}°EÒ´E¸Ee¼E¥ÀE3ÄEÈEêÌEnÐEÔEhØEÜEàE’äEåèEÅìEQðErôEÉøE)üEgF*FJF F9F=FýF×F[ F2$F=(Fw,Fè0FL4FO8FÆ°ü¹ÿÿÿÿò®÷ÑYÿƒÄôÿvèeƒD$ðƒÄ+à‹üƒÄüSÿ6Wè¨ïÿÿÆ;:ƒÄøÿvD;P舃ƒÄ EüPEøPWÿ5ôtèÕƒƒÄ…Àt^ƒÄøEôPVèåþÿÿ‹ÐƒÄ…Òt@‹Mô…Ét ‹B$‰A$‹Eüë‹B$‰F$ƒÄôRèÑýÿÿƒÄƒ=Ì©t/ƒÄôh Õè¬ôë‹Eü‰F$ëÇF$ƒÄôWè¬r‰EøƒÄƒÄüVÿuøÿ5ôtèX…ƒÄƒ=Ì©tKƒÄôÿv ÿvƒÄôƒÄôFPèÜîÿÿƒÄPèãîÿÿƒÄPÿv ¸ÐÕƒ~t¸ÆÕPÿvÿvÿ6hàÕè!ôeØ[^_ÉÃU‹ìƒìWVS¡ôt…À„.ƒÄôP臃ąÀ„ƒÄøEüPÿuèÓýÿÿ‹ðƒÄ…ö„þ‹Uü…Òt‹F$‰B$éÉÇEø‹>°ü¹ÿÿÿÿò®÷ÑYÿƒÄôÿvèµD$ðƒÄ+à‹üƒÄüSÿ6WèøíÿÿÆ;:ƒÄøÿvD;PèØƒÄ jEøPWÿ5ôtè'‚ƒÄ…ÀuhÖh$hÖhÖè7†‹F$…Àu!ƒÄøWÿ5ôtèš„ƒÄôÿuøè{íÿÿƒÄ ëƒÄüPÿuøÿ5ôtèÚƒƒÄƒÄôVèúûÿÿƒÄƒ=Ì©tƒÄôh9ÖèÕòeØ[^_ÉÃU‹ìƒì,WVS‹E‹}‹]ƒ} t…Àuh`ÖhRhÖhÖè—…‹Uƒzu;…ÿ„…Û„ƒÄøP‹M Qèq‹U‰BƒÄøSWèq‹M‰A ée‹ð+u ƒþubƒÄüjhÖ‹E PèÛìÿÿƒÄ…ÀuH…ÿ„¼…Û„´;û„¬‹U‹…ÀtƒÄôPèjìÿÿƒÄƒÄøSWè–p‹M‰éúƒþucƒÄüjhˆÖ‹E PètìÿÿƒÄ…ÀuI…ÿ„U…Û„M;û„E‹U‹B…ÀtƒÄôPèìÿÿƒÄƒÄøSWè.p‹M‰A鑃þ…_ƒÄüjhÖ‹E PèìÿÿƒÄ…Àuu…ÿ„é…Û„á;û„Ù+ßC$ð+à‹ôƒÄüSWVè£ëÿÿÆ3ƒÄƒÄôVè§Ñ=ÿÿÿÿt‹UÇB‰B¡øt‹M9AƒÇAéùƒÄüjh•Ö‹E PèyëÿÿƒÄ…À…²Ý¨ÖÝ]è…ÿtQ…ÛtM;ûtI+ßC$ð+à‹ôƒÄüSWVèëÿÿÆ3ƒÄƒÄüEèPhÖVè:ëÿÿÝEèݨÖÝéßà€äD€ô@u ÝØ3Àë{‹EÇ@ÙÀÙ}þf‹MþfÉ f‰MüÙmüß}ô‹Eô‹UøÙmþøt‹U‰BÙîÚéßà€äD€ô@u1ÇBë(ƒþu!ƒÄüjh¡Ö‹U Rè¤êÿÿ…Àu ‹MÇA ¸eÈ[^_ÉÃU‹ìƒì,WVS‹]èŸøÿÿ‰Eü3ö‹û‰uô‰uð‰uì‰u芈EûG„À„>ƒþ ‡àÿ$µX׶EûöEà8@…îŠEûß<]‡%€}û"„€}û=„€}û;„€}û,„ýGÿ‰EôŠˆEûG¾é|ŠEûß<]w€}û"t€}û=t€}û;t €}û,…³€}ût€}û;t€}û=t¶EûöEà8@„˜Gÿ‰Eð¾é¶EûöEà8@…f€}ût€}û;uÇEèÇEì¾éá€}û=…>ŠˆEûG¾éöEûöEà8@…€}û"u‰}슈EûG„À„ë¾éŽ€}û;t€}ûuGÿ‰Eìë1Gÿ‰EìÇEè¾éb€}û;t€}ûuƒ}è…`ÿÿÿGÿ‰EèéUÿÿÿ¶EûöEà8@tGÿ‰E芈EûG¾éÇEèëk¶EûöEà8@uZë€}û"uGÿ‰E芈EûG¾éÝŠˆEûG„À„éÆ€}û;„Ðþÿÿ€}û„Æþÿÿ¶EûöEà8@tŠˆEûGé–¾ 鋃Äô‹EèP‹EìP‹EðP‹EôP‹EüPèdúÿÿƒÄ …ÀuM‹]ð+]ôC$ð+à‹ôƒÄüS‹EôPVè„çÿÿÆ3ƒÄƒÄüVƒÄôhÀÖèlæÿÿƒÄPjèiì¾ ƒÄë€}ûtŠˆEûG3ö€}ûu¾ F÷=‡ ýÿÿƒþ u‹EüëaƒÄô‹EüPè¨õÿÿƒÄƒþ uƒÄü¾EûPƒÄôhàÖè÷åÿÿƒÄë&è;çÿÿƒÄô‹EüPèpõÿÿƒÄøƒÄôh ×èÌåÿÿPjèÌë3ÀeÈ[^_ÉÃU‹ìS‹M¶¸à8‹ØöS„A¶öCt ‹ÓA¶öBuöŠA<.u¶öCtvA¶öCt‹ÓA¶öBuöŠA<.uW¶öCtNA¶öCt‹ÓA¶öBuöŠA<.u/¶öCt&A¶öCt‹ÓA¶öBuö€9u ¸ë3À[ÉÃU‹ìƒì WVS‹]ƒ=Ì©tƒÄôh§×è^ëƒÄƒÄôSèÿÿÿƒÄ…Àt ƒÄø‹E PSè£äÿÿ…À”À%ÿéAƒ=Ì©tƒÄôh®×èëƒÄƒÄø‹U RSè×åÿÿƒÄ…À„ƒ=Ì©tƒÄôh±×èÞêƒÄ¾3ÿëGƒÿwƒÄøÿ4½ HSèæpƒÄ…Àtã¾€;.tNƒÄøj.SèiƒÄ;ÆŒ€ƒ=Ì©tƒÄôh´×èxêƒÄƒÄøS‹E Pè—pƒÄ…ÀtRƒ=Ì©tƒÄôh·×èJêƒÄ€;.t7‹û°ü¹ÿÿÿÿò®÷ÑQÿ‹} ü¹ÿÿÿÿò®÷ÑAÿ;Â~+‹U €|ÿ.t3Àëƒ=Ì©tƒÄôhº×èòé¸eè[^_ÉÃU‹ìƒìƒÄøÿuÿu è<ÉÃU‹ìƒìVS‹]‹u ƒÄôjè˜äÿÿ£øtƒÄôSèÂùÿÿ‹ØƒÄ …Û„΋…Àt/ƒÄøÿvPèþÿÿƒÄ…Àu,ƒ=Ì©„›ƒÄüÿvÿ3hÀ×ëAƒÄôÿvèqg‰ƒÄ‹C…Àt5ƒÄøÿvPè]ÿÿÿƒÄ…Àu6ƒ=Ì©tYƒÄüÿvÿshØèéƒÄëAƒÄôÿvè%g‰CƒÄ‹F ‰Cƒ{tƒÄôSèÓôÿÿƒÄôSèîñÿÿëƒÄôSèKóÿÿë…Ût ƒÄôSèÓñÿÿ¸eè[^ÉÃU‹ìƒì WVSÇEüƒ=ôtu 3Àéÿ‹}°ü¹ÿÿÿÿò®÷ÑYÿƒÄô‹U Rè’vD$ðƒÄ+à‹ôƒÄüS‹MQVèÓâÿÿÆ3:ƒÄø‹E PD3Pè²vƒÄ ƒÄøVÿ5ôtè„vƒÄ…Àt‹U9Uü}‹M‰ÇEüƒÄøj.‹EPèf‹øƒÄë`ƒÄøj.Vèñâÿÿ‹ØƒÄ…Ûuh"ØhchÖhÖè×zƒÄøSÿ5ôtèvƒÄ…Àt‹U9Uü} ‹Mü‹U‰ŠÿEüs‹ÇO=˜‹Eüeè[^_ÉÃU‹ìƒìWS‹U €:/u,B‹ú°ü¹ÿÿÿÿò®‹Ù÷ÓCÿƒÄüPRÿuègâÿÿ…Àu‹Ãë3Àeè[_ÉÃU‹ìƒìS‹U‹]¡øt9Brƒz tƒ}tƒÄøÿrÿu è‡ÿÿÿ…Àu3Àë…Ût‰¸‹]èÉÃU‹ìƒì WVS‹u‹] ƒÄø‹ÿp‹ÿpèCàÿÿ‹øƒÄø‹ÿp ‹ÿp è/àÿÿ‹Ð‹Ç…Àu‹Âeè[^_ÉÃU‹ìƒìWVS‹]hôVj ‹E PSè¯áÿÿÇEüƒÄ‹E H9Eü}~C ‰Eø‹ó‹>‹^ ƒÄøÿsÿwèÑßÿÿƒÄ…ÀuIƒÄøÿs ÿw è¼ßÿÿƒÄ…Àu4‹Eü@9E ~ƒÄü‹E H+Eü@ÁàP‹EøPVèQáÿÿƒÄƒEøôƒÆôÿMüÿM ƒEø ƒÆ ÿEü‹E H9Eü|Š‹E eØ[^_ÉÃU‹ìS‹E‹U ‹H‹@‹Z+Ø‹B+Áu‹Ã[ÉÃU‹ììœWVS‹}‹u E°‰E¨»S‹U¨RVWèóüÿÿ‰E¤ƒÄ;Ã~…$ð+à‰e¨‹]¤ë׃}¤trƒÄôjèdàÿÿ£øtÇEœÇE˜ƒÄ‹M¤9Mœ}D‹E˜‹U¨‹‚@‰E€…Ût$j‹MQ‹EPSèðýÿÿƒÄ…ÀtÿEœ‹[$…Ûuß‹U€‰U˜‹M¤;Ñ|¾ƒ}œu3Àé`‹UœR…$ð+à‰e ÇE”ÇE˜‹M¤9M˜}|Ç…xÿÿÿ‹E˜‹U¨‹‚@‰E€…ÛtT‹µxÿÿÿE¬P‹MQ‹EPSèfýÿÿƒÄ…Àt-‹U ‰2‹;°ü¹ÿÿÿÿò®÷ÑI‰L2‹E¬‰D2ƒÆ ƒ…xÿÿÿ ÿE”‹[$…Ûu³‹U€‰U˜‹M¤;Ñ|Ž‹Eœ9E”th,Øh/hÖhÖèEwƒÄø‹UœR‹M Qè€ýÿÿ‰EœhøWj P‹U Rè8ßÿÿÇEŒƒÄ ‹Mœ9MŒ}5‹] ‰M˜‹3‹~°ü¹ÿÿÿÿò®‹Ñ÷Ò‹~ ü¹ÿÿÿÿò®÷ÑDÿEŒƒÃ ÿM˜uÑ‹]œK‹EŒDX ‰EŒƒÄôPèfa‰E¡:Ø‹U‰¡>؉B B؈BÇEˆÇE˜ƒÄ‰]„‹Mœ9M˜Ÿ‹E ‰…|ÿÿÿ‹•|ÿÿÿ‹‹S‹ú°ü¹ÿÿÿÿò®÷Ñqÿ‹{ ü¹ÿÿÿÿò®÷Ñyÿ‹EEˆƒÄüVRPè·Ýÿÿuˆ‹U‹MˆÆ=A‰Mˆ‹ÂÁƒÄüWÿs Pè•Ýÿÿ}ˆƒÄ ‹E„9E˜}‹U‹MˆÆ;AÆ A‰Mˆƒ…|ÿÿÿ ÿE˜‹Eœ9E˜Œjÿÿÿ‹U‹MˆÆ AÆ AÆA‹EŒ;ÈthCØhahÖhÖè±u‹E¥Xÿÿÿ[^_ÉÃU‹ìƒì WVS‹U3ÛƒÄü‹E +ÂPj:Rè¹Ýÿÿ‹ð…öt?N;M s-¶F¿à8öGt›¾\PÐA;M s¶öGuç;M r ‹E‰0‹Ãë3Àeè[^_ÉÃU‹ìƒìLWVS‹]ƒÄøhVØSè^Ýÿÿ‰EôƒÄ…Àu$ƒÄôÿ5ð­èÆÛÿÿPSh`Øjèpá釃ÄôjèÆÜÿÿ£øtéG‹Eø‰EÄÇEü‹Ð€:„¶ºà8‹òöB@tÿEÄ‹MÄ€9„¶öB@uè‹}ÄŠ„À„ê<#„â„Àt%¶öEà8@tÿEÄ‹EÄ€8t ‹Ð¶öF@uê‹MĉMì€9t#¶öEà8@uÿEÄ‹}Ä€?t ¶öF@tì‹EĉEü9Eì„|€8t$‹Ð¶öEà8@tÿEÄ‹MÄ€9t ¶öF@uì‹UÄ€:t$¶öEà8@uÿEÄ‹}Ä€?t ¶öF@tì;UÄ„‹EÄ€8t#‹Ð¶öEà8@tÿEÄ‹MÄ€9t ¶öF@uì‹}ĉ}è€?t#¶öEà8@uÿEÄ‹EÄ€8t ‹Ð¶öF@tê‹MĉMä9M脶€9t"¶öEà8@tÿEÄ‹}Ä€?t ¶öF@uì‹EĉEà€8t%‹Ð¶öEà8@uÿEÄ‹MÄ€9t ¶öF@tì‹UÄ9Uà„S€:t#¶öEà8@tÿEÄ‹}Ä€?t ¶öF@uì‹EĉEÜ€8t%‹È¶öEà8@uÿEÄ‹}Ä€?t ¶öF@tì‹EĉEØ9EÜ„ì€8t$‹È¶öEà8@tÿEÄ‹}Ä€?t ¶öF@uì‹EĉEÔ€8t%‹È¶öEà8@uÿEÄ‹}Ä€?t ¶öF@tì‹EĉEÐ9EÔ„„+Uà‰UÈUü‰UÌ€8t$‹È¶öEà8@tÿEÄ‹}Ä€?t ¶öF@uì‹UÄ‹ú°ü¹ÿÿÿÿò®÷Ñ\ ÿ;Úv¶CÿöEà8@tK;]Äv ¶CÿöF@uðè{çÿÿ‰EðƒÄø‹EÐP‹UÔRè<]‹Mð‰AƒÄøS‹}ÄWè)]‹Uð‰B ƒÄ ƒÄø‹MäQ‹}èWè]‹Uð‰BƒÄƒ}Èu‹u࿃عü¨ó¦uÇB ƒÄü‹MÌQÿuü‹}ìWèûÿÿƒÄ…Àt‹Uð‰Bë¸P‹Mðƒy t¸»‹}ð‰GƒÄøÿuü‹EìPèœ\‹Uð‰‹ øtI‰J‹}ØƃÄü‹ÂPhˆØ‹EÜPè‚Øÿÿ¡øtƒÄ ‹Uð9BrÇBƒÄôRèèÿÿë ƒÄô‹MðQè¨æÿÿƒÄƒÄô‹}øWèõ×ÿÿƒÄƒÄô‹EôPèÆd‰EøƒÄ…À… ûÿÿƒÄô‹UôRè¼Øÿÿe¨[^_ÉÃU‹ìƒì WVS‹}‹u‹] …Ûteƒ{tV‹C;øtrKƒÄôÿs ÿsPºŒØ‹Âƒ{ t¸ƒØPÿs‹Â€?.u¸ƒØPWh’ØVèbØÿÿƒÄ0öF t ¸ë ‹[$…Ûu3Àeè[^_ÉÃU‹ìƒìVS‹u¡ôt…À„XƒÄôPè¿oƒÄ…À„Dƒ=Ì©tƒÄøVh©Øè‘܃ăÄôjèj×ÿÿ£øtƒÄøhÀØVè·×ÿÿ‹ØƒÄ …Ûu.ƒÄôÿ5ð­è ÖÿÿPVƒÄôh`ØèÁÕÿÿƒÄPjè¾ÛéÕƒÄøShÂØè¢×ÿÿƒÄüƒÄôjè!\Ph×ØSèy×ÿÿƒÄ0ƒÄøShóØèx×ÿÿƒÄüSh”`ÿ5ôtè nƒÄ öC t+ƒÄôÿ5ð­èÕÿÿPVƒÄôhÙè>ÕÿÿƒÄPjè;ÛƒÄ ƒÄôSè×ÿÿƒÄ…À}+ƒÄôÿ5ð­èbÕÿÿPVƒÄôh)ÙèÕÿÿƒÄPjèÛƒÄ ƒ=Ì©tƒÄôhAÙègÛeè[^ÉÃU‹ìƒìVS‹]‹u ƒÄøSÿ5ôtè»lƒÄôSèžÕÿÿƒÄ …öt‹^$ƒÄôVè,äÿÿ‹óƒÄ…öuë3Àeè[^ÉÃU‹ìƒì¡ôt…Àt(ƒÄüjh”bPè¡mƒÄôÿ5ôtè iÇôtÉÃU‹ìƒìWVS‹u‹} ÷Eøÿÿÿ„…Çð­¸ÿÿÿÿ釀û?t'€û*„€éO€û[„ €û\tJé9Š„ÉtP‹E%t€ù/tAöE„!€ù.…;} t)…À„ €ÿ/…ë‹E¨uŠF8„ê¸é÷öEt€?.u;} tâöEt€ÿ/tÖŠFëöEt€?/tÀû?u€?t¹ŠFG€û?tâ€û*tÝ„Û„¢ˆ]ÿöEu €û\uŠˆEÿN€?tŠ€û[tŠEÿ8uƒÄü‹E$ûPWVè¸þÿÿƒÄ…À„bG€?uÓéXÿÿÿŠ„É„LÿÿÿöEt€ù.u;} „8ÿÿÿöEt €ÿ/„(ÿÿÿ‹Ö…öt,ŠëBt%Š„Àt<]uó…Òt€:u€ù[„ééúþÿÿÇEøŠþÿÿŠF…Àu€û\uF€û]uæƒ}øté!þÿÿ:…þÿÿGŠF„Û…ˆýÿÿ€?…þÿÿ3ÀeØ[^_ÉÃU‹ì‹U€:t#Š<*t /th"Ýh™hqÙhwÙèÕ^Æ[F€~t€8/uÆ.@€8uòÆ]Æ@ƒ=Ì©t.ƒÄôh@Ýè˃ă=Ì©tƒÄüVShbÝè‚˃Ä‹Þƒ=Ä©uƒÄüSh|ÝjèáʃăÄøS‹UÄRèÁ-‹øƒÄƒÿ„ówƒÿ„hé[ƒÿt ƒÿ7tnéIƒÄøhZÚjè¡ÈƒÄøƒÄôh`ÚèyÄÿÿPjè‰ÈƒÄ0ƒÄô‹EäPè¢ÄÿÿƒÄƒ=Ì©tƒÄø‹UäRh—ÚèÍʃăÄô‹EÄPé ƒÄøhZÚjè9ȃÄøƒÄôhàÚèÄÿÿPjè!ȃÄ0ƒÄô‹UäRè:ÄÿÿƒÄƒ=Ì©tƒÄø‹EäPh—ÚèeʃăÄô‹UÄRé ƒÄøhZÚjèÑǃÄü‹Eÿp ƒÄôhŒÝè£ÃÿÿƒÄPjè ÉƒÄ ƒÄô‹UäRèÉÃÿÿƒÄƒ=Ì©tƒÄø‹EäPh—ÚèôɃăÄô‹UÄRèàò¸éžè›Äÿÿƒ=Ä©u*ƒÄøƒÄôhFÜë ƒÄøƒÄôh¦Ýè ÃÿÿPjè0ÇƒÄ ‹EÔ‰EÀƒeÀ„ ƒ}„ÿ‹U ƒ:…óƒ=À¨t!ƒ=Ä©uƒÄü‹Eÿp$h½ÝjèÐȃăÄü‹U R‹Eÿp$‹]ƒÃSèH1‹øƒÄ‰]ăÿtw ƒÿtxënƒÿugƒÄøhZÚjè˜ÆƒÄøƒÄôh`ÚèpÂÿÿPjè€ÆƒÄ0ƒÄô‹UäRè™ÂÿÿƒÄƒ=Ì©tƒÄø‹EäPh—ÚèÄȃăÄô‹UÄRéªèsÃÿÿƒ=Ä©uƒÄøƒÄôhFÜèÂÿÿPjèÆƒÄ ƒ}¼„ªƒ=\©ŽTƒ=Ä©uƒÄøhÎÝjèåŃăÄøuøV‹]ƒÃSèŸ(‹øƒÄGñ‰]Ä=(‡ÿ$…LáƒÄøhZÚjè¡ÅƒÄøƒÄôh`ÚèyÁÿÿPjè‰ÅƒÄ0ƒÄô‹EäPè¢ÁÿÿƒÄƒ=Ì©„ɃÄø‹UäRh—ÚèÉǃÄé°ƒÄøhZÚjèAŃÄøƒÄôhàÚèÁÿÿPjè)ŃÄ0ƒÄô‹UäRèBÁÿÿƒÄƒ=Ì©tƒÄø‹EäPh—ÚèmǃăÄô‹UÄRéRƒÄøhZÚjèÙăÄøƒÄôhàÝëƒÄøhZÚjè½ÄƒÄøƒÄôhÞè•ÀÿÿPjè¥ÄƒÄ0ëèÓÁÿÿƒÿ…æf¶EüÁàf¶UýƒÄüj·ØSVè-Èÿÿ‰EìƒÄ…À‹=ð­ƒÄô‹EäPèyÀÿÿƒÄƒ=Ì©tƒÄø‹UäRh—Úè¤ÆƒÄƒÄô‹EÄPèïƒÄôƒÄôWèPÀÿÿPSƒÄôVèY_ƒÄPƒÄôh Þèä¿ÿÿƒÄPjèáŸÿ’… ¸é ÇEЃ=Ä©uƒÄøƒÄôhŒÛ蜿ÿÿPjè¬ÃƒÄ ƒ}Ð…?ƒ=Ä©uƒÄøh@Þjè‡ÃƒÄƒÄô‹]ƒÃSè%‹øƒÄGþ‰]Ä=5‡Óÿ$…ðáƒÄøhZÚjèIÃÄøƒÄôh`Úè!¿ÿÿPjè1ÃÄ0ƒÄô‹UäRèJ¿ÿÿƒÄƒ=Ì©tƒÄø‹EäPh—ÚèuŃăÄôÿuìèeÌÿÿƒÄô‹UÄRéOƒÄøhZÚjèÙƒÄøƒÄôhàÚé߃ÄøhZÚjè¹ÂƒÄüƒÄôÿ5ð­èà¾ÿÿPhNÞjè‹ÄƒÄ0ƒÄô‹UäRè´¾ÿÿƒÄƒ=Ì©tƒÄø‹EäPh—ÚèßăăÄôÿuìèÑËÿÿƒÄô‹UÄR黃ÄøhZÚjèEƒÄüƒÄôÿ5ð­èl¾ÿÿPƒÄôhZÞè¾ÿÿƒÄPjè ăÄ0ƒÄôÿuìè}Ëÿÿ‹Çé: ƒÄøhZÚjèõÁƒÄøƒÄôhlÞèͽÿÿPjèÝÁƒÄ0ƒÄô‹EäPèö½ÿÿƒÄƒ=Ì©tƒÄø‹UäRh—Úè!ăăÄôÿuìèËÿÿƒÄô‹EÄPèí‹Çé 迾ÿÿƒ=Ä©uƒÄøƒÄôhŒÛèS½ÿÿPjècÁƒÄ ƒ}„Kƒ}À„3ƒ=Ä©uƒÄü‹URh{Þjè ÃăÄø‹EP‹]ƒÃSèÊ&‹øƒÄƒÿ„\wƒÿ„ÍéÀƒÿtƒÿ7…®é­ƒ=H©t{‹UÔö tsƒÄü‹Eÿ°$ƒÄôh Þ袼ÿÿƒÄPjèŸÂƒÄƒÄô‹UäRèȼÿÿƒÄƒ=Ì©tƒÄø‹EäPh—ÚèóƒÄƒÄôÿuìèåÉÿÿƒÄôSèØë¸(é– ƒÄøƒÄôhàÞè8¼ÿÿPjèHÀÇEƒÄ ëèo½ÿÿƒÿt$ƒ=Ä©uƒÄøƒÄôhŒÛèþ»ÿÿPjèÀƒÄ ƒ}À„èƒ=À¨t9ƒ=Ä©u0ƒ}tƒÄøhZÚjèÚ¿ƒÄƒÄü‹Uÿr$hßjè²ÁƒÄƒÄø‹Eÿp$‹]ƒÃSè"&‹øƒÄƒÿt w ƒÿtIë?ƒÿ„Ûƒÿ7u.éIƒÄøhZÚjèq¿ƒÄü‹Uÿr$ƒÄôhßéº苼ÿÿƒ=Ä©uƒÄøƒÄôhFÜè»ÿÿPjè/¿ƒÄ ƒÄôh@¨è³éÿÿ‰ẼÄ‹EÔ¨„Õƒ=Ä©uƒÄøh,ßjèö¾ƒÄƒÄøj‹]ƒÃSè*&‹øƒÄƒÿ„wƒÿ„YéLƒÿt ƒÿ7t~é9ƒÄøhZÚj衾ƒÄøƒÄôh`ÚèyºÿÿPj艾ƒÄ0ƒÄô‹UäR袺ÿÿƒÄƒ=Ì©tƒÄø‹EäPh—ÚèÍÀƒÄƒÄôÿuìè½ÇÿÿƒÄôSè°é¸énƒÄøhZÚjè)¾ƒÄøƒÄôhàÚèºÿÿPj较Ä0ƒÄô‹UäRè*ºÿÿƒÄƒ=Ì©tƒÄø‹EäPh—ÚèUÀƒÄƒÄôÿuìèEÇÿÿƒÄôSè8é¸7éöƒÄøhZÚjè±½ƒÄüh:߃Äôh@ß脹ÿÿƒÄPjè¿ƒÄ ƒÄôÿuìèóÆÿÿ¸é­諺ÿÿƒ=Ä©uƒÄøƒÄôhFÜè?¹ÿÿPjèO½ƒÄ ƒÄôh@¨èÓçÿÿ‰ẼÄ‹U ‹…Àt8ƒ}t2ƒ}Ìt,+E9EÌu$ƒ=Ì©tƒÄôh€ßèv¿ƒÄ‹E ‹‰Ẽ}¼„ƒ}Ðu@ƒÄôEìPèÔÅÿÿ‹øƒÄƒÿ u*ƒÄüƒÄôÿ5ð­èù¸ÿÿPh¤ßj褾¸ éÞ¡D©…Àt ‹UöB„öƒÄô‹Eÿ°$èÕ$ƒÄƒ=Ø©tƒÄô‹Uÿ²$èÔ#ƒÄƒÄøh€‹Eÿ°$ècºÿÿƒÄøƒÄ¸³ßƒ}t¸°ßP‹Uÿ²$èÞ¹ÿÿ‹ðƒÄ…ö…µƒÄôÿ5ð­èC¸ÿÿP‹Eÿ°$h¶ßjèå½ƒÄ ƒÄô‹UäRè¸ÿÿƒÄƒ=Ì©tƒÄø‹EäPh—Úè9¾ƒÄƒÄô‹EPèçƒÄôÿuìèÅÿÿ¸éÒ‹ðƒ}u0ƒ=ªu'ƒÄôV誹ÿÿƒÄøjƒÄôV謹ÿÿƒÄPè³¹ÿÿ€f ÏƒÄ ‹U ‹…ÀtƒÄüƒÄôPè÷JPƒÄôh¾ßè)·ÿÿƒÄPjè&½ƒÄ ƒ}t0ƒÄüƒÄô‹U ‹+EPèÁJPƒÄôhÉßèó¶ÿÿƒÄPjèð¼ƒÄ ƒÄøhZÚjèE ‹‰ẼÄ邃}ÌtzƒÄüƒÄô‹UÌRèoJPƒÄôh¾ß衶ÿÿƒÄPjèž¼ƒÄ ƒ}t.ƒÄüƒÄô‹EÌ+EPè;JPƒÄôhÉßèm¶ÿÿƒÄPjèj¼ƒÄ ƒÄøƒÄôhÕßèO¶ÿÿPjè_ºƒÄ ‹EPj‹]ƒÃS‹EÌP‹UR‹E PVÿuìèå‰EàƒÄ ƒÄôjè=<‰E܃Äüj‹Uÿ²‹U ‹+EPèÞ‰EØƒÄ ƒÄôÿuìèeÃÿÿƒÄ‰]ă=D©t ‹Eö@t ƒÄôV蜷ÿÿë ƒÄôVè¸ÿÿƒÄ=ÿÿÿÿuÇEàþÿÿÿƒ}àþuxƒÄôÿ5ð­èÚµÿÿP‹Uÿ²$ƒÄôhàèsµÿÿƒÄPjèp»ƒÄ ƒÄô‹EäP虵ÿÿƒÄƒ=Ì©tƒÄø‹UäRh—ÚèÄ»ƒÄƒÄô‹EÄPè°ä¸énƒ}àÿuPƒÄôƒÄôÿ5ð­èYµÿÿP‹UØR‹EÜPƒÄôh@àèó´ÿÿƒÄPjèðºƒÄ0ƒ=Ä©tƒÄøhZÚjè布ăÄøEèP‹UÄRèæ‹øƒÄô‹EÄPèåƒÄ ƒÿ„ŒƒÄôÿuèè…µÿÿƒÄƒ}àÿt‹UØR‹EÜPh`àj耺ƒÄƒÄøƒÄôhkàèe´ÿÿPjèu¸ƒÄ ƒÄô‹UäR莴ÿÿƒÄƒ=Ì©tƒÄø‹EäPh—Ú蹺ƒÄƒÄô‹UÄRè¤ã¸éb‹Eè€82tLƒÄôPèó´ÿÿƒÄƒ}àÿt‹EØP‹UÜRh`àjèăÄøƒÄôh‡àèÓ³ÿÿPjèã·¸é ƒÄôP觴ÿÿƒÄƒ}àÿu¸éð‹EÔ¨u<ƒÄô‹UäRèͳÿÿƒÄƒ=Ì©tƒÄø‹EäPh—Úèø¹ƒÄƒÄô‹UÄRèäâƒÄƒ=Ä©„—‹Eö@„ŠƒÄôÿ°$衃ÄøhŸà‹Uÿ²$èï´ÿÿ‹ðƒÄ …öuBƒÄôÿ5ð­èX³ÿÿP‹Eÿ°$h¶ßjèú¸ë7ƒÄüSh¡àjè踃ÄôSèdzÿÿƒÄ ƒÄôVè›@‹ØƒÄ…ÛuÒƒÄôVè™´ÿÿ¸*e¨[^_ÉÃU‹ììÌWVS‹uƒ¾$uƒÄô‹EPèÐ#‰†$ƒÄƒ=ü¨tBƒÄôÿ¶$è8;ƒÄ…Àt-ƒÄüÿ¶$ƒÄôhàâèK²ÿÿƒÄPjèH¸¸"é:ƒÄôÿ¶$è^:ƒÄ‹<©‰•Pÿÿÿ…Òu ‹†$‰…PÿÿÿÇ…`ÿÿÿötÇ‹VÁêƒâ‰•\ÿÿÿF‰…Lÿÿÿ•dÿÿÿ‰•Hÿÿÿÿ…`ÿÿÿƒÄô‹…`ÿÿÿPè› ƒÄöt+ÇFƒÄô‹•LÿÿÿRè áƒÄ…Àt€füë8€Në2ƒÄô‹…LÿÿÿPèåàƒÄ…Àt€fþë€Nöt€fýë€NÇ…Xÿÿÿƒ½`ÿÿÿ ƒ=H©tgöFuKƒÄô‹•PÿÿÿRèó9ƒÄ…Àt5ƒÄø…xÿÿÿP‹…PÿÿÿP膳ÿÿƒÄ…Àu‹EŒ%ð=€u ‹U¨‰•Xÿÿÿƒ=H©t ƒ½Xÿÿÿ~€N ƒÄôjè÷6‰…TÿÿÿƒÄƒ=À¨„–ƒÄøj‹EPèç'‹øº 㡠㉅hÿÿÿ‹B‰…lÿÿÿŠBˆ…pÿÿÿƒÄhÿÿÿƒ½`ÿÿÿ~$ƒÄü‹•`ÿÿÿRƒÄôhãèV°ÿÿƒÄPSè\²ÿÿƒÄƒÄø‹…PÿÿÿPSW‹•TÿÿÿRhãjè2¶ƒÄ ƒÄôWè±ÿÿƒÄƒ} t‹U ‹B‰…dÿÿÿë Ç…dÿÿÿV‹…XÿÿÿP‹•HÿÿÿR‹EPè–ßÿÿ‹ØƒÄô‹•LÿÿÿRèA៎ …Àu€&ýë€Cÿ=6wCÿ$…Øã‹Ãé­ƒ} t‹U ‹B9…dÿÿÿt(ƒÄøÿ5Ȩ‹…`ÿÿÿP胃Äéè¿°ÿÿƒÄôjè’5‰…TÿÿÿƒÄüjÿ¶‹…dÿÿÿ+…XÿÿÿPè/þ‹ØƒÄ ƒÄø‹•PÿÿÿRjè!2ƒÄöt?ƒÄôÿvèV¯ÿÿƒÄƒ=Ì©tƒÄøÿvh—Ú肵ƒÄƒÄô‹…LÿÿÿPèiރăÄøÿµdÿÿÿ‹•PÿÿÿRS‹…TÿÿÿPƒÄôh6ãè½®ÿÿƒÄPj躴ƒÄ ƒ=À¨uSƒ=ĨuJƒÄøj‹URèÓ%‹ØƒÄü‹…`ÿÿÿP‹•PÿÿÿRÿµdÿÿÿS‹…TÿÿÿPh`ãjèj´ƒÄ0ƒÄôSèF¯ÿÿƒÄöFt)ƒ=è©…®ƒÄôÿµdÿÿÿènÿÀ©镃ÄôÿµdÿÿÿèRÿÀ©ƒÄƒ=ªtrƒ=Ì©tƒÄôh€ãèv´ƒÄƒÄü‹•PÿÿÿRƒÄôh½ãèÑ­ÿÿƒÄPjèγƒÄô‹…PÿÿÿPèG°ÿÿƒÄ …ÀtƒÄüƒÄôÿ5ð­èï­ÿÿPhËãjèš³ƒ½\ÿÿÿt €Né@ûÿÿ€fïé3ûÿÿ¡È¨…À„—ûÿÿ9…`ÿÿÿŒ‹ûÿÿƒÄô‹•LÿÿÿRè¸ÜƒÄ…Àt@öt;ƒÄôÿvèq­ÿÿƒÄƒ=Ì©tƒÄøÿvh—Ú賃ăÄô‹…LÿÿÿPè…ܸ,¥(ÿÿÿ[^_ÉÃU‹ìƒì WVS‹} ‹‡$‰Eü€'þ‹G $û‰GƒÄô‹URè ‹ØƒÄøh´äSè*7‹ðƒÄ ƒÄôSè”­ÿÿƒÄƒ=Ì©t ƒÄøVƒÄôhÀä臬ÿÿƒÄP賃ĉ·$ƒÄüWj‹EPè·ùÿÿ‹Ø‹Uü‰—$ƒÄƒû"uƒÄøÿ·VèÍ.‹U‰ƒÄë ‹Eǃ=è©tUƒÄôVè©®ÿÿƒÄ…Àt&ƒÄüƒÄôÿ5ð­èQ¬ÿÿPhËãjèü±ƒÄ ë"ƒÄüVƒÄôháäèÛ«ÿÿƒÄPjèرƒÄƒÄôVè´¬ÿÿ€g÷‹Ãeè[^_ÉÃU‹ìì¬WVS‹] ‹(HB£(H¡è¨=ÿÿÿÿt?B;Ð~:ƒ=Ì©tƒÄüPRƒÄôhåèk«ÿÿƒÄPèê±ÿ (H¸#éÄ…Ûuh,åhôhqÙhwÙè·D‰pÿÿÿ‹U‹‹Èƒáþ‰ ¨u€Jë‹}€gý‹E€HƒÄôPèdڃąÀu ‹U€Jë‹M€aþÇ…tÿÿÿ"…Û„¿èg…À…ï‹}‹¿$‰½hÿÿÿƒÄô‹Eÿp$èB/‰…dÿÿÿƒÄøÿs‹URèÝƒÄ ƒÄô‹MQè‹Ћ}‰—$Ç…tÿÿÿ"Ç…lÿÿÿƒÄƒ=Щ„΃;…ŃÄø…xÿÿÿPR責ÿÿƒÄ…À…ª‹M¨‹u¸3Ò‹‡…Àt=uº…Òt ;K”À%ÿë¸9s 6…ÀtNƒÄü‹Eÿ°$ƒÄôh@åèÑ©ÿÿƒÄPjèίDžlÿÿÿë:…ÀtƒÄü‹Uÿ²$ƒÄôh€åëƒÄüQƒÄôhÀåè‹©ÿÿƒÄPj舯ƒÄ‹=„¨‚¾=t=„Ðéìƒ=8©…Wƒ{u!ƒÄøƒÄôhæè-©ÿÿPjè=­ƒÄ 鶃Äø…xÿÿÿP‹Mÿ±$褫ÿÿƒÄ…À……‹{°ü¹ÿÿÿÿò®÷Ñyÿ‹EŒ%ð= udA$ð+à‹ôƒÄüQV‹Uÿ²$èl«ÿÿ‹ÈƒÄ;Ïu?‹C‹øü¨ó¦u3P‹Mÿ±$ƒÄôh@æè¨ÿÿƒÄPjè®Ç…lÿÿÿé ÿs‹}ÿ·$ƒÄôhhæè[¨ÿÿƒÄPjèX®ƒÄôÿ·$èÒªÿÿƒÄ ƒÄøÿ·$ÿsèîªÿÿƒÄ=ÿÿÿÿu!ƒÄüƒÄôÿ5ð­èc¨ÿÿPhƒæjè®ƒÄ ƒÄøhZÚjè ¬é…ƒ½lÿÿÿt|ƒÄü‹EPS‹URè&õÿÿ‰…tÿÿÿë`ƒ=بuXƒÄüÿsƒÄôhæë5ƒ½lÿÿÿt<ƒÄü‹MQS‹}Wèæôÿÿ‰…tÿÿÿë ƒÄüÿsƒÄôhÀæèu§ÿÿƒÄPjèr­ƒÄƒ;u ƒ=8©t]ƒ{ ÿt]ƒ½lÿÿÿtNƒÄô‹Eÿ°$è 0ƒÄ…Àt63Ò¡<©…Àtƒ=@©t‹Ðë ‹M‹‘$…Òt<ƒÄøÿs Rèë.ë+ƒ{ ÿu'ƒÄü‹}ÿ·$ƒÄôhäæèݦÿÿƒÄPjèÚ¬ƒÄ‹C…Àt$ƒ;uƒ½lÿÿÿtƒÄøP‹Eÿ°$èبÿÿë"ƒ=Ì©tƒÄø‹Uÿ²$hçè ­ƒÄƒÄô‹Mÿ±$è`§ÿÿ‹…hÿÿÿ‹}‰‡$ƒÄø‹•dÿÿÿR‹MQè¢ƒÄ ƒÄô‹½dÿÿÿWè,§ÿÿƒÄƒ½tÿÿÿ6t$ƒ½tÿÿÿtƒ½tÿÿÿt‹E€`ü‹[…Û…Dûÿÿƒ=بtk¡è¨=ÿÿÿÿt ‹(H;Ð}1ƒÄü‹UR‹pÿÿÿQ‹}WèV‰…tÿÿÿë6ÿ (H¸6ë3ƒ=Ì©tƒÄüPRƒÄôh@çè¡¥ÿÿƒÄPè ¬ÿ (H‹…tÿÿÿ¥Hÿÿÿ[^_ÉÃU‹ìƒìWVSÇEüé[‹E ƒ8…C‹M‹q ‹þ°ü¹ÿÿÿÿò®÷щMø‹E ‹X‹û°ü¹ÿÿÿÿò®÷Ñ‹EøTÿB‹Ë…À~ B$ð+à‰eüŠ„Àt u¦‹Ãeè[^ÉÃU‹ìƒì|WVS‹]ƒÄøhÐéSèb…ÿÿ‰E¸ƒÄ…Àu$ƒÄôÿ5ð­èʃÿÿPShÓéjèt‰3ÀéåÇEœÇE ƒÄô‹E¸Pè‰E¤ƒÄ…Àt ƒÄôPè'„ÿÿƒÄƒÄô‹U¸Rèø‰E¤ƒÄ…Àt ƒÄôPè„ÿÿƒÄƒÄô‹M¸QèÖ‰E¤ƒÄ…À„.ƒÄôéƒÄøháé‹u¤Vè»…ÿÿ‰E”ƒÄ…Àu‰u”ƒ=Ì©tƒÄø‹E”Phtìè<‰ƒÄ‹]”Šº…ì„Àt<;tCŠ„Àt<;uõ€;;uÆ‹}”°ü¹ÿÿÿÿò®÷Ñ‹u”\ÿCü‹ú¹‹ðü¨ó¦uÆCüƒÄô‹E”Pèô‰EÀƒÄƒ=Ì©tƒÄøPhë軈ƒÄ€{üu"ÇE¼ÇEă=Ì©t+ƒÄôh[ëëÇE¼ƒ=Ì©tƒÄôhŠìèsˆƒÄÇEăÄøháéj貄ÿÿ‰E”ƒÄ…À…·ƒ=Ì©tƒÄôhìè6ˆƒÄƒÄô‹U¤R茂ÿÿƒÄô‹M¸Qè`‰E¤ƒÄ …Àu"ƒ=Ì©„êƒÄôhÀìèô‡éÕƒÄô‹u¤Vè°ñÿÿ‹ØƒÄ…Ûu+ƒ=Ì©tƒÄôhíèÁ‡ƒÄƒÄô‹E¤P鑃Äøháé‹U¤Rèóƒÿÿ‰E”ƒÄƒ=Ì©tƒÄø‹M”Qh4íè{‡ƒÄƒÄøh ëjèÁƒÿÿ‰E”ƒÄƒ=Ì©tƒÄøPhHíèL‡ƒÄƒÄô‹u”VèÔƒÿÿ‰E¬ƒÄøh ëj肃ÿÿ‰E”ƒÄ …Àu,ƒ=Ì©tƒÄôh`íè ‡ƒÄƒÄô‹E¤PéÙ3ÛU܉U˜ëCƒû ƒÄøÿ4dH‹M”Qè7€ÿÿƒÄ…Àuຫªª*‹Â÷ëÑú‹ÃÁø+ÐRÁà+؉]°ƒÄøháéjèô‚ÿÿƒÄôPè+ƒÿÿ”øÿÿ‰E´ƒÄ ƒ=Ì©tƒÄôhíèr†ƒÄƒÄøháéj赂ÿÿ‰E”ÇE¨3ÿ‹ØƒÄôSèÞ‚ÿÿ‹ðƒÄ ëCŠ„Àt=<:uõ€;t4ƒÄôCS躂ÿÿ‹øƒÄëCŠ„Àt<:uõ€;tƒÄôCSè–‚ÿÿ‰E¨ƒÄƒ=Ì©t'ƒÄü‹U¨RWV‹M¬Q‹E°P‹E´lPh íèË…ƒÄ ‹U¨‰U܉}à‰uä‹M¬‰Mè‹u°‰uì‹E´‰EðÇEôÇEøÇEüÿÿÿÿƒÄô‹U˜Rè‚ÿÿ‰Eȃă=Ì©tƒÄøPhKëèl…ƒÄƒÄøháéjè±ÿÿƒÄøhÓíjè¢ÿÿƒÄ ƒÄøhÕíjèÿÿ‰E”ƒÄ…Àu*ƒ=Ì©tƒÄôhàí腃ăÄô‹M¤Q鮃Äô‹u”VèPúÿÿ‰Ẽă=Ì©tƒÄüPVh îèÚ„ƒÄÇEЃ} u3ƒÄôj èa‰E ‰Eœ‹øu¼ü¹ó¥‹u ÇFÇFë3‹Eœ‰EÔƒÄôj è(‹Uœ‰B‰Eœ‹øu¼ü¹ó¥‹uœÇFƒÄƒÄô‹E¤Pè½~ÿÿƒÄƒÄô‹U¸RèŽ ‰E¤ƒÄ…Àt%ƒÄôPèîÿÿ‹ØƒÄ…Û…²úÿÿƒÄô‹M¤Qè‚~ÿÿƒÄƒÄô‹u¸Vècÿÿ‹E ¥xÿÿÿ[^_ÉÃU‹ìƒì WVS‹}‹E =„†‚¯=t =t~éƒÄøhÐéWèÿÿ‹ØƒÄ…Ûu!ƒÄôÿ5ð­èk}ÿÿPWhÓéjèƒ3ÀëoƒÄôSè/€ÿÿ‹ðƒÄôSèÔ~ÿÿFÐƒÄ = w ƒÄôWèzõÿÿëBƒÄøjë5ƒÄôWèùÿÿë/ƒÄøjë!ƒÄøƒÄôh@îè°|ÿÿPjè°‚ƒÄ ƒÄøjWèJíÿÿeè[^_ÉÃU‹ìƒìWVS‹]¡D©…Àu?ƒÄøhwîSè=~ÿÿ‹ðƒÄ…öu*ƒÄôÿ5ð­è¦|ÿÿPShÓéjèP‚¸éT‹ð‹U ‹B(…À„´ƒÄôPèO׉EüƒÄ‹M ‹A,…ÀtƒÄôPè6׃Ä‹Øë3ÛƒÄô‹}ü°ü¹ÿÿÿÿò®‹Ñ÷Ò…Ût‹ûü¹ÿÿÿÿò®‹Â+ÁëBPè÷ÿ‹øƒÄôƒÄ‹Ãºzî…Ûu‹ÂP‹Â…Ût¸ëP‹EüPh{îWèª}ÿÿƒÄ ƒÄô‹UüRè{|ÿÿƒÄ…ÛtƒÄôSèk|ÿÿëƒÄôhzîè‹øƒÄƒÄøh îVèH}ÿÿƒÄøhÔîVè:}ÿÿƒÄ ƒÄô‹M ÿq ÿqÿq ƒÄôhêîè+{ÿÿƒÄPVè}ÿÿƒÄ ƒÄøhïVè}ÿÿƒÄô‹E ÿp ÿpÿp ƒÄôhêîèôzÿÿƒÄPVèÚ|ÿÿƒÄ0ƒÄøhïVèÉ|ÿÿƒÄƒ}„¦ƒÄøh/ïVè®|ÿÿƒÄ‹Uƒz ÿtbƒÄô‹Â Pè²{ÿÿ‹ØƒÄôÿs ‹CÁàÿ°”H‹ClPh2ïVèj|ÿÿƒÄ0ƒ{t ÿsÿsh>ïëƒÄøhJïVèF|ÿÿƒÄëƒÄøƒÄôhRïè@zÿÿPVè)|ÿÿƒÄ ‹M‹=tr =t%ë3ƒÄøƒÄôhfïë.ƒÄøƒÄôhsïëƒÄøƒÄôh€ïëƒÄøƒÄôhïèÜyÿÿPVèÅ{ÿÿƒÄ ƒÄô‹Eÿp蠋؃Äô‹U ÿr ÿrWhšïVèš{ÿÿ‹M ‹A ƒÄ0€8/tÿyƒÄøVj/èÍ|ÿÿƒÄë ‹FÆ/ÿFƒÄü‹E ÿp h²ïVè[{ÿÿ‹U ‹B ƒÄ€8tÿyƒÄøVj/èŽ|ÿÿƒÄë ‹FÆ/ÿFƒÄüSh²ïVè {ÿÿƒÄ‹Mƒ9uÿyƒÄøVj/èV|ÿÿƒÄë ‹FÆ/ÿFƒÄüShµïVèèzÿÿƒÄ‹Eƒ8uÿyƒÄøVj/è|ÿÿƒÄë ‹FÆ/ÿFƒÄøhºïVè±zÿÿƒÄ‹U‹…Àu-ƒÄüƒÄôÿrèg PƒÄôhÀïè™xÿÿƒÄPVèzÿÿƒÄ ë*=u!ƒÄü‹M‹A…Àu¸ÌïPhÒïVèSzÿÿƒÄÿyƒÄøVj è‘{ÿÿƒÄë ‹FÆ ÿFƒÄôSè*yÿÿ‹E‹@‰EƒÄ…À…ZýÿÿƒÄøhØïVèzÿÿƒÄôWèÿxÿÿƒÄ ƒ=D©u ƒÄôVèÚyÿÿë ƒÄôVè_zÿÿ¸eØ[^_ÉÃU‹ìƒì WVS‹u‹] ‹}‹Ã…Û}C‹ÐÁú¶2Áà‰Eü¶D EüÁeü¶D EüÁâ+Ú;º+ЋÊÓmüº+׸ÿÿ‹ÊÓø!Eü‹Eü[^_ÉÃU‹ìƒìWVS‹]‹E ‰]ðÆfÇEü‹‰Uô‹@‰Eø3ÿ3öEô‰EìƒÄüjV‹UìRèQÿÿÿøƒÄƒÆƒþ?~ä‹ÇÀàˆEüƒÄüj j‹EìPè,ÿÿÿ‹…àH‰ƒÄ€;t+€{t€{tC€{uCëCë Cë‹Ã‹ØÆ CƒÄüj j ‹UìRèØþÿÿ‹…àH‰ƒÄ€;t+€{t€{tC€{uCëCë Cë‹Ã‹ØÆ CƒÄüj j‹EìPè„þÿÿ‹…àH‰ƒÄ€;t+€{t€{tC€{uCëCë Cë‹Ã‹ØÆ CƒÄüj j!‹UìRè0þÿÿ‹…àH‰ƒÄ€;t+€{t€{tC€{uCëCë Cë‹Ã‹ØÆ CƒÄüj j,‹EìPèÜýÿÿ‹…àH‰ƒÄ€;t+€{t€{tC€{uCëCë Cë‹Ã‹ØÆ CƒÄüj j7‹UìRèˆýÿÿ‹…àH‰ÆCƒÄƒ=Ì©tƒÄø‹EðPhðïèÆ{‹EðeØ[^_ÉÃU‹ìƒì,WVSè:$ð+à‹ô‹} °ü¹ÿÿÿÿò®‹Ñ÷Ò‹}ü¹ÿÿÿÿò®÷ÑD $ð+à‹ÜƒÄø‹E PSèwÿÿƒÄø‹MQSè%xÿÿƒÄ ƒÄôVè펃ÄüV‹û°ü¹ÿÿÿÿò®÷ÑAÿPSèåŽƒÄ ƒÄø]ðSVèñŽ‹Eð3Eø‰Eð‹Uô3Uü‰Uô‰EèEè‰PƒÄ‹UÿM‹ø…Ò~M‹ßƒÄôVè‹ŽƒÄüVjWè“ŽƒÄ ƒÄøMðQV蟎‹Eð3Eø‰Eð‹Uô3Uü‰Uô‰Eè‰SƒÄ‹EÿM…À¶ƒÄøWh uè¨üÿÿ¸ ueÈ[^_ÉÃU‹ì‹U‹M €:t¾;Áu‹Âë B€:uî3ÀÉÃU‹ìVS‹u‹] ‹M3Ò;Ñ} Š2ˆB;Ñ|õ[^ÉÃU‹ìƒì WVS‹u‹Du‹Hu+ÚÁãC$ð+à‹üƒÄüSW–Rè¨ÿÿÿƒÄü‹Hu¡äh+ÂÁàP¡DuÁàÆP–Rè€ÿÿÿƒÄ ƒÄüS¡ähDu+Hu†PWè^ÿÿÿ‹äh‹Â+HuDu‰Hueè[^_ÉÃU‹ìƒìWVS‹]Çàhƒ=ähuÇähÇHuÇDuÇLu‹UŠ<-uÇPuB‰Uë><+uÇPuÿEë+ƒÄôhðèûuÿÿƒÄ…Àt ÇPuë ÇPu¡Lu…Àt €8…Zƒ=Puus‹Du¡Hu;Ðt;äht"ƒÄô‹M Qè„þÿÿƒÄë¡äh;Ðt£Du¡ähë¡ähH‰ äh‹Á;E}‹U ‹‚€8-uà€xtÚ¡äh£Hu¡äh;Etc‹M ‹4¿ð¹ü¨ó¦uBP‰äh‹Hu9Dut@;ÐtƒÄô‹M QèëýÿÿƒÄë@£Du‹E£Hu£äh¡äh;Eu¡Du;Hut%£ähë‹M ‹€:-uŠJ„Éu.ƒ=Puu ¸ÿÿÿÿé‰àhÿäh¸éø3À…Ût €ù-”À%ÿ@ЉLu…Û„¶¡äh‹U ‹‚€8-…¢€x-t ƒ}„’‹5LuÇEøÇEôÇEðÇEìëFŠ„Àt<=uõÇEüë!ƒ}ðu‰]ð‹Mü‰Mìë ÇEôƒÃÿEü‹ …ÉtIƒÄü‹Lu‹Æ+ÂPRQèrÿÿƒÄ…ÀuØ‹Ö+Lu‹;°ü¹ÿÿÿÿò®÷ÑAÿ;Ðu ‰]ð‹Uü‰UìÇEøƒ}ôt^ƒ}øuXƒ=èht,¡äh‹M ÿ4ÿ5$ªƒÄôhðè pÿÿƒÄPhPªèëqÿÿ‹Lu‹ú°ü¹ÿÿÿÿò®÷ÑD ÿ£Luéqƒ}ð„²¡ähP‰äh€>„·‹MðƒytF‰5àhé6ƒ=èhtoP‹M ‹D‘ü€x-u+‹Eðÿ0ÿ5$ªƒÄôh@ðèooÿÿƒÄPhPªèQqÿÿë7ƒÄô‹Mðÿ1‹M ‹D‘ü¾Pÿ5$ªƒÄôh€ðè6oÿÿƒÄPhPªèqÿÿ‹Lu‹ú°ü¹ÿÿÿÿò®÷ÑD ÿ£Lu¸?éË‹Uðƒz…‡@;E}‹M ‹£àhÿähënƒ=èht(‹U ÿt‚üÿ5$ªƒÄôhÀðèµnÿÿƒÄPhPªè—pÿÿ‹Lu‹ú°ü¹ÿÿÿÿò®÷ÑD ÿ£Lu¸?‹U€::…C¸:é9‹Lu‹ú°ü¹ÿÿÿÿò®÷ÑD ÿ£Luƒ}t‹Mì‹U‰ ‹Eð‹P…Òt‹@ ‰3Àéõ‹Uð‹B éçƒ}t1¡äh‹M ‹€x-t ƒÄø¡Lu¾P‹EPèèùÿÿƒÄ…À…‘ƒ=èhtj¡äh‹U ‹‚€x-u+ÿ5Luÿ5$ªƒÄôhñè²mÿÿƒÄPhPªè”oÿÿë0ƒÄôÿ5Lu¾Pÿ5$ªƒÄôh ñè€mÿÿƒÄPhPªèboÿÿÇLu@ñÿäh¸?é"¡LuŠÿLuƒÄø¾óV‹MQè/ùÿÿ‹LuƒÄ€:uÿäh…Àt€û:u>ƒ=èht"Vÿ5$ªƒÄôhAñèýlÿÿƒÄPhPªèßnÿÿ‰5ìh¸?é©€x:…™€x:u€:t ‰àhëvÇàhëm€:t ‰àhëZ¡äh;EuBƒ=èht"Vÿ5$ªƒÄôh`ñèylÿÿƒÄPhPªè[nÿÿ‰5ìh³?‹E€8:u³:ë‹U ‹‚£àhÿähÇLu¾ÃeØ[^_ÉÃU‹ìƒìƒÄøjÿuÿuÿuÿu ÿuèñøÿÿÉÃU‹ìƒìƒÄøjjjÿuÿu ÿuèÏøÿÿÉÃU‹ìS‹M3Ò»ˆñ‹“;ÁsBƒúFvó‹Á[ÉÃU‹ìƒì WVS‹u ‹]ƒÄôjè×ï‹ø‰7‰_ƒÄô‹EPè°ÿÿÿ‰G@…Ò}ƒÂÁú‰WÇG ƒÄ ƒÄôÁàPè›ï‰GƒÄü‹GÁàPjÿwèÈnÿÿ‹Çeè[^_ÉÃU‹ìƒìS‹]ƒÄôÿsè'lÿÿƒÄôSèlÿÿ‹]èÉÃU‹ìƒìWVS‹]‹{‹C‰EüƒÄô‹U R‹ÿÐ3Ò÷s4׋[‰]øƒÄƒ>t/‹Eü\ÇøƒÄøÿ6‹U R‹Uøÿ҃ąÀu‹Ç;ótF‹ðƒ>uÛ3À…Àu 3Àë‹Æëó‹@eØ[^_ÉÃU‹ìƒìWVS‹]‹{‹C‰EüƒÄô‹U R‹ÿÐ3Ò÷s4׋[‰]øƒÄƒ>t/‹Mü\ÏøƒÄøÿ6‹E P‹Uøÿ҃ąÀu;‹Ç;ótF‹ðƒ>uÛ3Ò…Òt)ƒ}t‹‹M‰ƒ}t‹B‹U‰¸ë ‹ÖëÓ3ÀeØ[^_ÉÃU‹ìƒìWVS‹]‹{‹C‰EüƒÄô‹U R‹ÿÐ3Ò÷s4׋[‰]øƒÄƒ>t6‹Eü\ÇøƒÄøÿ6‹U R‹Uøÿ҃ąÀt‹Æë‹Ç;ótF‹ðƒ>uÔ3À…À•À%ÿeØ[^_ÉÃU‹ìƒìWVS‹E‹@‰Eü‹U‹B‹Mü Á‰MøƒÄôÀPètýÿÿ‹U‰B@…Ò}ƒÂÁú‹M‰QƒÄôÅSè_í‹øƒÄ ƒÄü‹U‹BÁàPjWè‰lÿÿ‹M‰y‹uüƒÄ‰]ô‹Eø;ðsT‹^…ÀtAƒÄôP‹U‹ÿЋM3Ò÷q ׃ă9t‹EôTø‹Ç;ÊtA‹Èƒ9uð‹‹V‰‰Q‹ó;uør¯ƒÄô‹UüRè“iÿÿeØ[^_ÉÃU‹ìƒìWVS‹u‹~‹F‰Eü‹V‰UøƒÄô‹E P‹ÿÐ3Ò÷v׃ă;t?‹UüT×ø‰UôƒÄøÿ3‹E P‹Uøÿ҃ąÀt‹E ‰‹U‰Së2‹Ç;]ôtC‹Øƒ;uËÿF ‹E ‰‹U‰S‹F9F ~ ƒÄôVè|þÿÿeØ[^_ÉÃU‹ìƒìWVS‹E‹p‹xƒÄô‹U R‹ÿЋM3Ò÷qÖ‹A‰EüƒÄƒ;t+|þøƒÄøÿ3‹U R‹MüÿуÄ…Àu‹Æ;ßtC‹Øƒ;uÛ3Û…Ûu 3À锋U‹B‹rÇÿJ ÁàLø‹Ö;ÙtS‹Úƒ;td‰Eô‰Mø‹;ƒÄôW‹M‹ÿЋM3Ò÷q փă9t‹EôTø;9t ‹Æ;ÊtA‹Èƒ9uì‹‹S‰‰QÇ‹Æ;]øtC‹Øƒ;u£¸eØ[^_ÉÃU‹ìƒìS‹]ƒÄü‹CÁàPjÿsèBjÿÿÇC ‹]èÉÃU‹ìƒì WVS‹E‹X‹@Áà<;ßs2‹…Òt%‹òƒÄü‹EPÿsV‹U ÿ҃ąÀu‹‹Ð;Æt…ÀuÛƒÃ;ßrÎeè[^_ÉÃU‹ì‹E‹@ ÉÃU‹ì‹M¾…Àtë ‹ÐÁâ+оÂA€9uîÉÃU‹ìƒìƒÄøÿu ÿuèfÿÿ…À”À%ÿÉÃU‹ìƒìƒÄüh,ÑhÑÿuè=úÿÿÉÃU‹ìS‹M¶ºà:¶…ÀtA€9t‹Ú‹ÐÁâ+ж¶ÂA€9uê[ÉÃU‹ìƒìƒÄøÿu ÿuè gÿÿ…À”À%ÿÉÃU‹ìƒìƒÄüh¨ÑhlÑÿuèÁùÿÿÉÃU‹ìƒìWVS‹u‹} ÇEøPƒÄôjPèŒé‰3ۃċEøH;Ø~ƒÄø‹EøÀ‰EøPÿ7è™é‰ƒÄ‹†…ÀuF‰†ƒÄôVè°”ƒÄ‰† …À~H‰†‹‹–Šˆÿ†¸=u}‹‹Ð€< uöEu<…Ûtaƒûu€: t.ƒÄøEÿPVèr”ƒÄ…ÀtO=ÿÿÿÿu¸ëkŠEÿ< tA< t=‹…Û~#‹Ê¶Dÿ¾à8öF@tK…Û~ ¶DÿöF@uðÆë…Àu¸¸ë#Céÿÿÿƒ=Ì©tƒÄøÿ7h¤òèÈj3ÀeØ[^_ÉÃU‹ìƒì WVS‹]‹M ‹}€9t'¶¾à:ë AC€9t¶¶Š280të€9uŠC<:t3ÀëƒÄôSè·؃ÄøÿuSÿ×eè[^_ÉÃU‹ìƒì WVS‹}‹ß3ö¾‹Â%ÿ¹à8öAt¶tBÐC¾‹Â%ÿöAuè;ßtƒÄôSèW€<u ‹E ‰0¸ë3Àeè[^_ÉÃU‹ìƒìS‹] ƒÄôÿuèï牸‹]èÉÃU‹ì‹E ǸÉÃU‹ì‹M‹ÁŠë@Š€ú tø€ú tó€ú tî€ú té+ÁÉÃU‹ìƒìƒÄôÿuèofÿÿÉÃU‹ìƒìƒÄôÿuè[fÿÿÉÃU‹ìS‹M‹U ‹]‹A‰‹‰[ÉÃU‹ìƒì‹E‹U ;P|;|hÀòjqhéòhðòèü‹@‹‹E‰ÉÃU‹ìWV‹M‹U ;Êu ¸ë(‹;u‹q‹z …ü¨ó¦”À%ÿë3À^_ÉÃU‹ìƒì‹U‹E ;Bthóh‹héòhðòèšûH‰J‹Á;|ÇBÉÃU‹ìƒì WVS‹}3öƒÄôjè æ‹ØƒÄƒ?t Fƒ<·uù…öh"óh¢héòhðòè8û‰3ÇCƒÄôµPèÃå‰CÇC 3É;Î}‹C‹‹‰ˆA;Î|ð‹Ãeè[^_ÉÃU‹ìƒìVS‹]ƒÄôjèå‹ðÇÇFƒÄôjèfå‹Ð‰VÇF ‹‰‹Æeè[^ÉÃU‹ìƒìS‹]ƒÄôÿsèûaÿÿƒÄôSèòaÿÿ‹]èÉÃU‹ìƒìS‹]‹C Pÿ‰S ƒ=Ì©tƒÄü‹ÂPSh@óèWgƒÄƒ{ #ƒ=Ì©tƒÄøShaóè7gƒÄƒÄôSèƒÿÿÿ‹]èÉÃU‹ìƒì‹EƒÄôÿ0èdÿÿÉÃU‹ìƒìVS‹]‹u ƒ=TuuƒÄôjèÃúÿÿ£TuƒÄÿF ƒÄüVƒÄôSèåƒÄPÿ5Tuè¤÷ÿÿƒÄƒ=Ì©tJƒÄøShvóèªf3ÛƒÄ;}&ƒÄøƒÄô‹F˜PèjÿÿÿPh„óèƒfƒÄ C;|ÛƒÄôhˆóènfeè[^ÉÃU‹ìƒì WVS‹u‹} 3ÛƒÄôVèbcÿÿ‰EüƒÄ=ÿÿÿÿtƒÄôEüPèAþÿÿéä¡Tu…ÀtƒÄøVPèeôÿÿ‹ØƒÄ…Ût$ƒ=Ì©tƒÄüSVh óèôeÿC 颅ÿuƒÄüVƒÄôhÊóèK_ÿÿƒÄPjèHeƒÄƒÄôVèäbÿÿ‹ØƒÄ…Ûu3…ÿu*ƒÄüƒÄôÿ5(ªè†PƒÄôhÛóè_ÿÿƒÄPjèe3Àë9…ÿuƒÄøƒÄôhèóèä^ÿÿPjèädƒÄ ƒÄôÿsèÖüÿÿ‹ØƒÄøSVè>þÿÿ‹Ãeè[^_ÉÃU‹ìƒìS‹]‹S…Òuhïóh6héòhðòèø¡$©…ÀtƒÄøRPè1ƒÄ…Àt¡(©…ÀtƒÄøÿsPè…Àt3À븋]èÉÃU‹ìƒìWVS‹} °ü¹ÿÿÿÿò®÷ÑI‰MøÇEü‹Uƒ:„€‹uü‹E‹°‹û°ü¹ÿÿÿÿò®÷ÑI‹}øxE…ÿ|A¶‹u ¶7Š’à:8à:u(‰]ô»à:OIx…ÿ|‹Uô¶‹u ¶7Š8tâƒùÿu ¸ëÿEü‹Eü‹Uƒ<‚u3À[^_ÉÃU‹ìƒì‹E=t=t=t=u ƒÄôhÿóë ƒÄôhôèS]ÿÿÉÃU‹ìƒìS‹] ƒÄôÿuè+^ÿÿƒÄƒ{ thôhshéòhðòè¡öƒÄôSèïûÿÿ3À‹]èÉÃU‹ìƒì¡Tu…Àt(ƒÄüjhÚPè%öÿÿƒÄôÿ5TuèñÿÿÇTuÉÃU‹ìƒì,WVS‹} ‹M‹E‹@‰EüöÁtP;}s¶ºà8öB@tG;}s ¶öB@uñ9}v)‹U¶Bÿºà8öB@tÿM9}v ‹]¶CÿöB@uë‹u‰uø)}øöÁ„Õ‹Eø$ð+à‰eô‰}è‹Üƒá‰Mì;þƒ‹UèŠ<&tˆB‰Uèéõ‹Mè‰MðÿEè‹u9uè„Ï‹Ö+Uè‹Eè€8#un@‰Eè;Æ„¶¾‹Â%ÿ¿à8öG„3É9uès6‰LBÐÿEè‹U9Uès"‹u辋Â%ÿÀö8uÙö€à8ˆ…`ˆ CéBƒúv{‹Eè¿0ô¹‹ðü¨ó¦u!€x;tƒút‹È¶AöEà8ŒuÆ<ë:ƒúv?‹Eè¿3ô¹‹ðü¨ó¦u)€x;tƒút‹È¶AöEà8ŒuÆ>CƒEè鿃úv;‹Eè¿6ô¹‹ðü¨ó¦u%€x;tƒút‹È¶AöEà8Œu Æ&CƒEèë~ƒú†‹‹Eè¿:ô¹‹ðü¨ó¦u!€x;tƒút‹È¶AöEà8ŒuÆ"ë:ƒúvO‹Eè¿?ô¹‹ðü¨ó¦u9€x;tƒút‹Ð¶BöEà8ŒuÆ CƒEè‹M9Mès(‹uè€>;uF‰uèë‹Eð‰E芈ÿEèC‹U9Uè‚êýÿÿÆC‹û+}ô‹Ç‹MA‹Y;Ø}Ûƒûõ»ëî‹u;^tIƒ~ uƒÄøSÿ6è+Þ‰ƒÄë+ƒÄôSèëÝ‹ðƒÄü‹Eÿpÿ0Vè¬Zÿÿ‹U‰2ÇB ƒÄ ‹M‰Y‹]‹CƒÄüW‹uôVPèZÿÿ{é­‹Eø‹UB@‹Z‹Óƒá‰Mì;Ø}Ûƒûõ»ëî;ÚtQ‹Mƒy uƒÄøSÿ1èÝ‹u‰ƒÄë-ƒÄôSèKÝ‹ðƒÄü‹Eÿpÿ0Vè Zÿÿ‹U‰2ÇB ƒÄ ‹M‰Y‹]‹CƒÄü‹uøVWPèáYÿÿ‹‹EøCÆ‹C@ƉCƒ}ìt ‹Uü‹E€:t¹à:¶ŠˆB€:uòeÈ[^_ÉÃU‹ìƒì WVS‹]‹u+u …Ût>ëƒÃ‹…Òt/‹ú°ü¹ÿÿÿÿò®÷ÑAÿ;ðrâƒÄüV‹E PRèˆYÿÿƒÄ…Àu̓;u3Àë¸eè[^_ÉÃU‹ìƒì WVS‹E‹u ‹ÈÆEÿ»;΄àŠAx;Îu»ƒû ‡·ÿ$¤ô€ú!„”éBB÷¾À=5wÿ$…Øô3Ûé‚» éw¶ÂöEà8Œu€ú.t€ú-t €ú_…ø»éK¶ÂöEà8Œ…ï€ú.„æ€ú-„Ý€ú_„Ô»€ú-…»é€ú't€ú"thDôhÏh]ôhjôè­ðˆUÿŠA» éÍ:Uÿu{» éº:Uÿ„ hˆôhÝh]ôhjôèfð€ú-th™ôhâh]ôhjôèFðŠA»ëk€ú-uŠAëZ»ëV€ú-u»ëIŠAëD€ú-th™ôhýh]ôhjôèòïŠA» ë€ú-u ŠA»ë»ƒû‡.þÿÿt‹Áë‹Çeè[^_ÉÃU‹ììŒWVS‹E ‹u0‰UÌÇEÈÇEÄìÀ‰eÀ…À„©ÇEìÄÿÿÿ‰eèÇEðÇEô‰eøÇEüÇEðÇE¼ÇE¸ƒÄü‹EÌ+ÆPjýÿÿ‹ðƒÄ;ó„Ýë›>…AƒÄüSW‹EPè/üÿÿƒÄÇE°…ÀtÇE°jSWEèPèÝ÷ÿÿƒÄÇE˜¾‹È%ÿöEà8@t!ºà8F;ũÈ%ÿöB@u技ú/uLF;ũ˾‹È%ÿöEà8@t#ºà8F;ũ¦¾‹È%ÿöB@u技ú>…}€ú>„ø‰u¬‹Á%ÿöEà8Œu€ú.t €ú-t€ú_u-F;ũR¾‹È%ÿöEà8ŒuâŠ<.tÜ<-tØ<_tÔ‰u¨9u¬„‹Á%ÿöEà8@t#ºà8F;ũ¾‹È%ÿöB@uæ¶ÉöMà8ŒuŠ<.t<-t <_tu‹U¬‰Uœ‰U¤‹}¨‰} é<=…¤F;ũ¦¾‹È%ÿöEà8@t"ºà8F;ũ‚¾‹È%ÿöB@uæŠ<"t<'uf3ɉuœF;ũW‰u¤ëF;ũFŠ:Ðt…Éu€ú uå‹u¤¹ëç€ú>uÓ‰u :Ð…ØüÿÿF;ũ‹þÇE˜ëR‰u¤¶ÉöMà8@u$<>t ºà8F;ũڶöB@u€>>uè‰u 9u¤„´‹]¤‰]œ‹þÇE˜ƒ}°…ýÿÿƒ}tƒÄü‹E¨P‹U¬R‹]Sè}ùÿÿƒÄ…À„jýÿÿ‹E¼@‹]ÈUè‰Uˆ‰E‹U¼Ò‰UŒ+}œ‰}”;Ø}Ûƒûõ»ëî;]Èt[ƒ}ÄuƒÄø[ÁàP‹EÀPèÖ‰EÀƒÄë7ƒÄô[ÁàPèÑÕ‹ø‹UÈRÁàƒÄüP‹EÀPWèŒRÿÿ‰}ÀÇEÄƒÄ ‰]È‹]Œ]¼Áã‹Eð‹UÀ‰Dj‹E¨P‹U¬R‹EˆPèŠôÿÿ‹Eð‹UÀ‰D‹E˜P‹U R‹E¤P‹UˆRèkôÿÿ‹Uœ‹EÀ‰T‹U”‰T ‹]‰]¼ƒÄ étüÿÿƒ}°tFëg‹Eè‰EЋE¸‰EÔ‹U¼‰UØ~uÐ…Ò~&3Ò‹M¼‹]À‹DE艋DEè‰DƒÂIuâ‹EÀ‰EÜ‹U´‰Uà‰}äƒÄø‹]SV‹EÿЃÄ‹÷;uÌséÎúÿÿ‹u´FéÃúÿÿƒ}ôuƒÄôÿuèèkQÿÿƒÄ‹Eø‰Eè‹Eü‰EìÇEðÇEôƒ}Äu ƒÄô‹UÀRè3öƒÄø‹E P‹G ÿ40è²OÿÿƒÄ…Àuƒ}t‹E‰‹G ‹D0ëƒÆC;_|Ç3Àeè[^_ÉÃU‹ìƒì WVSƒÄô‹EPè׬‰EüƒÄ‹U‹Z…Û…›‹Z…Û…ƒ=Ì©tƒÄü‹MQÿr h€öèWTƒÄƒ}üu*‹uV‹Eÿp ƒÄôhÀöè¯MÿÿƒÄPjè¬S3ÀéxƒÄøj‹URè&¯‹ðƒÄ…ö…­ƒ=Ì©tÔƒÄü‹MQ‹uÿv hèöèéS뻃Äø‹EPSèKÄ‹øƒÄƒ=Ì©tƒÄôW‹URS‹Mÿq h÷è°SƒÄ ƒÄøjWè±®‹ðƒÄ…öu0ƒ=Ì©tƒÄüW‹uÿv h@÷è{SƒÄƒÄôWè×Mÿÿé>ÿÿÿƒÄôWèÇMÿÿƒÄƒ=Ì©tƒÄøÿ6he÷èDSƒÄƒÄôj èÚЋ؋û3Àü¹ó«‰C‰3‹u‹N ‹URÁà‹u‹‹L+ʉK‹M‹Q ‹D ‰CŠE $ÀàŠS€âï ЈSƒ}üu‹u€>/t€Êë€ÊˆS‹U‹B…Àt‰X‰Zë ‹M‰Y‰Y‹Ãeè[^_ÉÃU‹ìƒì,WVSÇEøÿÿÿÿ3ÿ‹E9itGƒÿ}‹U9…iuë‰}øƒ}øÿuh€÷h®hŒ÷h—÷èMåÇEü‹Mü‹E ;HÊ‹UøR …‰Mì‰EäƒÁ‰Mà‹E ‹P ‹MüIÁà‹T‰Uô‹}øA‰Mèƒÿ}|‹M‹Uì9Šiun‰Eð‹]àÃi‹uäÁæƒÄøÿsü‹U ‹B ‹Mðÿ4è™LÿÿƒÄ…Àu%ƒÄô‹EP‹UüR‹M Q‹4%P‹EôPèðüÿÿƒÄ ƒÃ ƒÆ Gƒÿ} ‹U9–it¦‹Mè‰Mü‹E ;HŒPÿÿÿeÈ[^_ÉÃU‹ìƒì WVS‹} ‹uƒÄüEüPhGöWè?üÿÿ‹ØƒÄ…ÛtNƒÄôVÿuüWjSè‚üÿÿƒÄ …Àt7€H ‹F…Àt ƒÄôPèwKÿÿƒÄ‹F…Àt ƒÄøSPèoÁë ƒÄôSè ωFeè[^_ÉÃU‹ìƒìWVS‹u ƒÄüEüPhGöVèÂûÿÿ‹øƒÄ…ÿteƒÄüjhdöVè©ûÿÿ‹ØÇEøƒÄ…Ût1ƒÄøhµ÷SègKÿÿƒÄ…ÀtƒÄøhÀ÷SèRKÿÿƒÄ…ÀuÇEøƒÄôÿuÿuüV‹EøPWè°ûÿÿeØ[^_ÉÃU‹ìƒì WVSƒÄüjhTö‹E Pè0ûÿÿ‹ØƒÄüjhYö‹E PèûÿÿƒÄ …À„ƒÄøhÎ÷PèÞJÿÿƒÄ…À…ï3ÿƒÄüEüPhLö‹E PèàúÿÿƒÄ…À„‚‹Ð¾ ‹Á%ÿ»à8‹óöCt¿|AÐB¾ ‹Á%ÿöCuèŠB<;…F¶¹à;öF@t B¶öF@uö¶€<U…¶B€<R…¶B€<L…€z=…øƒÂ¶‹MüöF@t B¶öF@uöƒÄô‹EPQ‹E PjRèzúÿÿ…À„ÀH ‰x é·…Û„­ƒÄøhÖ÷SèÎIÿÿƒÄ…À…”ƒÄüjhLö‹E PèÔùÿÿ‹ØƒÄ…ÛtxƒÄøhÝ÷Sè™IÿÿƒÄ…Àu^‹EÇ@ëWƒÄøj,Sè™Iÿÿ‹øƒÄ…ÿtGë‹û°ü¹ÿÿÿÿò®÷Ñ| ÿƒÄü‹Ç+ÃPhâ÷SèIÿÿƒÄ…Àu ‹EÇ@‹ß€;u«eè[^_ÉÃU‹ìƒìVS‹u‹] ƒÄôÿ6èìøÿÿ‹ÐƒÄƒúÿuhë÷h\hŒ÷h—÷èá‹ÕôhƒÄüSVRÿÐeè[^ÉÃU‹ìƒì,WVS‹u‹} ƒÄôVèÔՋ؃Ä…Ûu'ƒÄôÿ5ð­è‘GÿÿPVh÷÷jè;M3Àé܃=Ì©tƒÄüÿsVhÿ÷è–MƒÄ‹‰EäÇEüÇEøÇEè…ÿu ¡ˆ©‰Eìë‰}ì‰uðÇEôƒ=Xuuè…öÿÿƒÄøEäPh¤ïÿ5\uÿ5Xuÿsÿ3èwðÿÿƒÄ ƒ=Ì©tƒÄüÿuôVhøèMƒÄƒ}t‹Eô‹U‰‹Eè…ÀtƒÄôPèRGÿÿƒÄƒÄôSè_Ö‹EøeÈ[^_ÉÃU‹ìƒì¡Xu…Àt ƒÄôPè GÿÿƒÄ¡\u…Àt ƒÄôPè GÿÿÉÃU‹ìƒì WVS‹]‹E ǃÄüjh@øSèGÿÿ…À…ۃËû3ö¾‹Â%ÿ¹à8öAt¶tBÐC¾‹Â%ÿöAuè€;.…›;û„“C‹ûëC¶öEà8uò€; uy;ûtu…ö~qC¾‹Â%ÿöEà8t\¾K‹Á%ÿöEà8tG¾s‹Æ%ÿöEà8t2”’ÿÿÿ’„‰ÿÿÿÀTЃÊ€ú t„Òu ‹U ‰ë¸ÿÿÿÿëC‹U ‰eè[^_ÉÃU‹ìƒì WVS‹]‹E ‰EüƒÄüjhFøSèFÿÿƒÄ…ÀuƒÃ€;:uCƒÄôSè‘áÿÿØ€;t}¶¸à8‹ðöVtm3É‹þ‰¾LBÐC¶öGuì€;-uN¶CöFtD‹Eü‰C3ɾ‹Â%ÿöFt‹þ‰LBÐC¾‹Â%ÿöGuè€;/u ¶CöFu3Àë0‹Eü‰HC3Éë ‰LBÐC¾‹Â%ÿöFuè‹Eü‰H¸eè[^_ÉÃU‹ìƒìS‹] ƒÄøhLøÿuèÞFÿÿ…Àt ÇëǸ‹]èÉÃU‹ìƒì WVS‹]‹u ƒÄøj;Sè&Eÿÿ‹ÐƒÄ…Òu‹û°ü¹ÿÿÿÿò®÷ÑT ÿ;Óv¶Bÿ¹à8öA@tJ;Óv ¶BÿöA@uñƒÄøRSè‹È‰¸eè[^_ÉÃU‹ìƒìƒÄøhQøÿuèšDÿÿ…Àu ‹E ǸÉÃU‹ìƒìÇ`u¡du…ÀtƒÄôPèâÿÿÇduƒÄƒ=Ì©tƒÄøÿ5huh`øèaIÉÃU‹ìƒìVS‹]‹u ƒ=`ut>¡hu;ĸƒÄôPèçBÿÿƒÄƒ=Ì©tƒÄøÿ5huhˆøèIƒÄè[ÿÿÿƒ=duth—øhih¯øh¶øèåÛƒÄøjÿuèsâÿÿ£duƒÄ…ÀuhÔøhnh¯øh¶øè²Ûf‰5lu‰huÇ`uƒ=Ì©tƒÄøShùè‚Heè[^ÉÃU‹ìƒìVS‹E ƒ=`u„‘f;lu…„ƒÄøjÿuèâáÿÿ‹ØƒÄ…ÛtnƒÄøSÿ5duè&ßÿÿ‹ðƒÄôSèŸàÿÿƒÄ …ötMƒÄôÿ5huèJKÿÿƒÄ…Àu?ƒÄôÿ5huè±AÿÿƒÄƒ=Ì©tƒÄøÿ5huhˆøèÚGƒÄè#þÿÿ3Àë¸eè[^ÉÃU‹ìƒìS‹]‹C…ÀtƒÄôPè BÿÿƒÄ‹C…Àt ƒÄôPèôAÿÿƒÄ‹C…Àt ƒÄôPèàAÿÿÇCÇCÇC‹]èÉÃU‹ìì¬WVSÇ…tïÿÿ‹Eöu&‹U ‹B,ƒ8uh(ùhih¯øh¶øèÚÇ…ÈïÿÿÇ…xïÿÿÇ…lïÿÿƒ=l©tƒ}t Ç…lïÿÿÇ…pïÿÿÇ…¼ïÿÿÇ…Àïÿÿ‹M ÇÇAÿÿÿÿÇA ÿÿÿÿÇAÇAÇA‹E‰…|ïÿÿ…Àu ‹U‰•|ïÿÿƒ½lïÿÿu!ƒÄø‹|ïÿÿ·A PÿqèêýÿÿƒÄ…À…—ƒÄøj‹…|ïÿÿÿpèàßÿÿ‹ØƒÄ…Ûu ¸éBƒÄô‹•|ïÿÿÿrèGÿÿƒÄüj‹|ïÿÿ·A PSèÍHÿÿ‰…ïÿÿƒÄ ƒÄôjèîFÿÿƒÄôSèiÞÿÿƒÄ ƒ½ïÿÿ}q¸=𭒅ݸéÓ‹…|ïÿÿÿp ÿpƒÄôh@ùè?ÿÿƒÄPjèE‹hu‰•ïÿÿƒÄƒ=Ì©tƒÄøRh_ùèvEƒÄÇ…¸ïÿÿtù‹Möt Ç…¸ïÿÿoùÇ…¬ïÿÿ‹E ‹P(…Òt3‹ú°ü¹ÿÿÿÿò®÷ÑA$ð+à‰¥¬ïÿÿƒÄüRhxù‹•¬ïÿÿRè˜@ÿÿƒÄÇ…°ïÿÿ™ù‹Möt Ç…°ïÿÿ†ù‹U ‹B…Àt;ƒÄôPèúÒ $ðƒÄ+à‰¥¨ïÿÿƒÄü‹M ÿqhšù‹…¨ïÿÿPè:@ÿÿƒÄë Ç…¨ïÿÿ‹Ü©…Òt$‹ú°ü¹ÿÿÿÿò®÷ÑA$ð+à‹ôƒÄøRVè@ÿÿë-‹¤t‹ú°ü¹ÿÿÿÿò®÷ÑA$ð+à‹ôƒÄüRh®ùVèÐ?ÿÿƒÄ‹U‹B(‰…Üïÿÿ‹B,‰…àïÿÿj…àïÿÿP…ÜïÿÿPÿrèüWƒÄ‹•Üïÿÿ…Òu‹`©‰•Üïÿÿ‹…àïÿÿ…Àu¡d©‰…àïÿÿÇ…¤ïÿÿ…Òti…Àteƒ½ÈïÿÿuƒÄüh¶ùPRè@%‰…¤ïÿÿëBƒÄô‹MQ褋؃ÄôS‹…¸ïÿÿPÿµàïÿÿÿµÜïÿÿÿµÈïÿÿèà+‰…¤ïÿÿƒÄ0ƒÄôSèÞ=ÿÿƒÄÇ… ïÿÿƒ}t<‹©…Òt ¡”©…Àu ‹M‹Q(‹A,…Òt…ÀtƒÄühÄùPRè°$‰… ïÿÿƒÄÇ…˜ïÿÿƒÄô‹Eÿp蛋M‹Q ƒÄ;Ðt8ƒÄôRèÑ$ðƒÄ+à‰¥˜ïÿÿƒÄü‹Eÿp hØù‹•˜ïÿÿRèU>ÿÿƒÄÇ…”ïÿÿƒ½lïÿÿu Ç…”ïÿÿÜùƒ=ªtj‹Mÿqÿq ÿqè½\ÿÿ‰…tïÿÿƒÄƒ}tƒÄô‹Eÿ0è‘ÀëƒÄô‹URèТ‰…´ïÿÿƒÄ‹½¸ïÿÿ°ü¹ÿÿÿÿò®‹Ñ÷Ò‹½´ïÿÿü¹ÿÿÿÿò®÷щ`ïÿÿ‹þü¹ÿÿÿÿò®‹Ù+Ó‹E‹X‹û°ü¹ÿÿÿÿò®)`ïÿÿ‹…`ïÿÿTú‰hïÿÿƒ½˜ïÿÿt‹½˜ïÿÿ°ü¹ÿÿÿÿò®÷ÑD ëB‹Ðƒ½”ïÿÿt‹½”ïÿÿ°ü¹ÿÿÿÿò®÷ÑT ÿƒ½¬ïÿÿt‹½¬ïÿÿ°ü¹ÿÿÿÿò®÷ÑT ÿƒ½tïÿÿt‹½tïÿÿ°ü¹ÿÿÿÿò®÷ÑT ÿƒ½¤ïÿÿt‹½¤ïÿÿ°ü¹ÿÿÿÿò®÷ÑT ÿ‹Úƒ½ ïÿÿt‹½ ïÿÿ°ü¹ÿÿÿÿò®÷Ñ\ ÿ‹½°ïÿÿ°ü¹ÿÿÿÿò®÷ÑQÿƒ½¨ïÿÿt‹½¨ïÿÿü¹ÿÿÿÿò®÷ÑD ÿëÚ‹h©…Òt‹ú°ü¹ÿÿÿÿò®÷ÑD ?ëC@$ð+à‹Ü‹Â…Àu¸™ùP‹•°ïÿÿR‹…¨ïÿÿ…Àu¸™ùP‹… ïÿÿ…Àu¸™ùP‹…¤ïÿÿ…Àu¸™ùP‹…tïÿÿ…Àu¸™ùP‹…¬ïÿÿ…Àu¸™ùP‹…”ïÿÿ…Àu¸™ùPhõù‹…˜ïÿÿ…Àu¸™ùP‹hïÿÿQV‹…´ïÿÿP‹•¸ïÿÿRhúSè­;ÿÿƒÄ@ƒ=Ì©tƒÄøSh`úè @ƒÄƒ½¤ïÿÿtƒÄô‹¤ïÿÿQèX:ÿÿƒÄƒ½ ïÿÿtƒÄô‹… ïÿÿPè<:ÿÿƒÄƒ½tïÿÿtƒÄô‹•tïÿÿRè :ÿÿƒÄƒÄô‹´ïÿÿQè :ÿÿƒÄü‹û°ü¹ÿÿÿÿò®÷ÑAÿPS‹•ïÿÿRè¿GÿÿƒÄ …À”ƒÄüƒÄôÿ5ð­è/9ÿÿPƒÄôh úèÑ8ÿÿƒÄPjèÎ>ƒÄ ƒÄô‹ïÿÿQèô8ÿÿƒÄƒ=Ì©tƒÄø‹…ïÿÿPhˆøè?ƒÄƒ=`ut‹•ïÿÿ;huuèPõÿÿ¸7éƒÄôP雃Äü¸Èúƒ}t¸ÂúPƒÄôhàúè;8ÿÿƒÄPjè8>Ç…€ïÿÿÿÿÿÿ‹€ïÿÿ‰ÐïÿÿÇ…Ìïÿÿ‰„ïÿÿ‹E€ ýƒÄø‹•ïÿÿRðïÿÿSè>gÇ…œïÿÿÇ…ˆïÿÿÇ…ŒïÿÿƒÄ Øïÿÿ‰dïÿÿÿ…ŒïÿÿƒÄüƒ½Œïÿÿ”À%ÿÀP‹…dïÿÿP•ðïÿÿRèÒÿÿ‹ÐƒÄƒú…Ø‹…Øïÿÿ€8„ɃÄøhûjè~;ƒÄøƒÄôh ûèV7ÿÿPjèf;ƒÄ0ƒÄôÿµØïÿÿè-8ÿÿƒÄ‹…Ìïÿÿ…Àt ƒÄôPè8ÿÿƒÄƒ½œïÿÿtƒÄô‹œïÿÿQèü7ÿÿƒÄƒÄô‹…ïÿÿPè97ÿÿƒÄƒ=Ì©tƒÄø‹•ïÿÿRhˆøèa=ƒÄƒ=`ut‹ïÿÿ; huuè”óÿÿ¸ éGƒú…ÛƒÄøhûjè¬:ƒÄüƒÄôÿ5ð­èÓ6ÿÿPƒÄôhDûèu6ÿÿƒÄPjèr<ƒÄ0ƒÄôÿµØïÿÿèI7ÿÿƒÄ‹…Ìïÿÿ…Àt ƒÄôPè37ÿÿƒÄƒ½œïÿÿtƒÄô‹…œïÿÿPè7ÿÿƒÄƒÄô‹•ïÿÿRèU6ÿÿƒÄƒ=Ì©tƒÄø‹ïÿÿQhˆøè}<ƒÄƒ=`ut‹…ïÿÿ;huuè°òÿÿ¸!écƒ=È©to‹½Øïÿÿ°ü¹ÿÿÿÿò®÷ÑYÿƒÄø‹µˆïÿÿóFP‹•œïÿÿRè빉…œïÿÿ…ˆïÿÿƒÄüSÿµØïÿÿPès6ÿÿ‰µˆïÿÿ‹œïÿÿÆ ÿ…ˆïÿÿ‹…ˆïÿÿÆƒÄ ƒ½Œïÿÿ…/ƒÄø…ÔïÿÿPÿµØïÿÿèïÿÿ‰…„ïÿÿ‹U ‰BƒÄƒ½„ïÿÿÿub‹…Øïÿÿ€8uƒÄôƒÄôhaûèû4ÿÿP虹‹M ‰AëƒÄôƒÄôhrûèÜ4ÿÿPèz¹‹U ‰BƒÄ ƒÄôÿµØïÿÿè¯5ÿÿƒÄéï‹…Ôïÿÿ€8u!ƒÄôƒÄôhˆûè™4ÿÿPè7¹‹M ‰AƒÄ ëƒÄôPè#¹‹U ‰BƒÄƒ½„ïÿÿÿ„Šƒ=Ì©…}ƒ=Ä©tÿµØïÿÿ‹ŒïÿÿQh™ûjèB:éSÿµÔïÿÿ‹…„ïÿÿPh¡ûjè#:é4‹…Øïÿÿ€8„ûÿÿƒ=Ä©tP‹•ŒïÿÿRh™ûjèð9ƒÄƒ½Ðïÿÿÿu0ƒ=Ô¨u'…ÐïÿÿPhœÓh¨ûÿµØïÿÿèƒÏÿÿƒÄ…À…̓½Ìïÿÿu'…ÌïÿÿPh¨óh·ûÿµØïÿÿèSÏÿÿƒÄ…À…‹M ƒyu(‹ÁPhÔhÄûÿµØïÿÿè"ÏÿÿƒÄ…À…l‹E ƒxu&PhÔhÍûÿµØïÿÿèóÎÿÿƒÄ…À…=ƒ=ªt$‹URh(ThÛûÿµØïÿÿèÆÎÿÿƒÄ…À…ƒ½Èïÿÿu'…ÈïÿÿPhÔhæûÿµØïÿÿè–ÎÿÿƒÄ…À…à‹Möt?…ÄïÿÿPhpóh÷ûÿµØïÿÿègÎÿÿƒÄ…Àtƒ½Äïÿÿ„¨‹E€ ï都€ïÿÿÿu3…äïÿÿPhtòhüÿµØïÿÿèÎÿÿƒÄ…Àt‹•äïÿÿ‰•€ïÿÿë_ƒ½lïÿÿuTƒ½Àïÿÿu#…ÀïÿÿPh,ÔhQøÿµØïÿÿèÚÍÿÿƒÄ…Àu(ƒ½¼ïÿÿu…¼ïÿÿPhôhüÿµØïÿÿè®ÍÿÿƒÄƒÄôÿµØïÿÿèÁ2ÿÿƒÄé úÿÿƒÄøhûjèÑ5ƒÄƒ½Ðïÿÿÿt?ƒ½Àïÿÿu ƒ½¼ïÿÿt-ƒ½lïÿÿthühAh¯øh¶øèËÇ…pïÿÿƒ½pïÿÿt ƒÄü‹ïÿÿQ‹•|ïÿÿ·B PÿrètîÿÿƒÄ½„ïÿÿ‘…eƒ½Èïÿÿ„x‹…Ìïÿÿ…ÀtƒÄôPè2ÿÿƒÄÇ…ÌïÿÿƒÄô‹M QèÆïÿÿƒÄƒÄô‹…ïÿÿPè(1ÿÿƒÄƒ=Ì©tƒÄø‹•ïÿÿRhˆøèP7ƒÄƒ=`ut‹ïÿÿ; huuè„íÿÿƒ½xïÿÿt7ƒÄøƒÄôh6üè0ÿÿPjèŸ4ƒÄ ƒÄôÿµÈïÿÿèf1ÿÿ¸5é ƒÄôÿµÈïÿÿ螃ąÀu3ƒÄôÿµÈïÿÿè51ÿÿƒÄøƒÄôh`üè50ÿÿPjèE4¸5é¼ ƒÄüjh€üÿµÈïÿÿè;1ÿÿƒÄ…Àu"‹•Èïÿÿ¶BöEà8@…Mÿÿÿ€z„CÿÿÿÇ…xïÿÿézïÿÿ‹…Èïÿÿ…ÀtƒÄôPè­0ÿÿÇ…ÈïÿÿƒÄ‹…„ïÿÿ8ÿÿÿ=cw‹E€‹…„ïÿÿÔþÿÿ=‡½„ïÿÿ,u‹U ƒzu‹M€ éæ‹E ƒxtƒÄôh†üèJ/ÿÿƒÄ븙ùP‹U ‹B…ÀuƒÄôh“üè'/ÿÿƒÄPƒÄôhŸüè/ÿÿƒÄPjè5ƒÄƒÄô‹ïÿÿQè9/ÿÿƒÄƒ=Ì©tƒÄø‹…ïÿÿPhˆøèa5ƒÄƒ=`ut‹•ïÿÿ;huuè”ëÿÿ‹…Ìïÿÿ…ÀtƒÄôPè•/ÿÿƒÄƒ½œïÿÿtƒÄô‹œïÿÿQèx/ÿÿ¸é‹…Ìïÿÿ…Àt"ƒÄüj h¯üPè’/ÿÿƒÄ…Àu ‹E€ë ‹U€"þƒ=ª„¢‹Mö„–ƒÄøj.‹U ‹B,ÿ0èß1ÿÿ‹ØƒÄ…Ût*ƒÄøh¹üSèh/ÿÿƒÄ…ÀtfƒÄøh¾üSèS/ÿÿƒÄ…ÀtQ‹M ‹Q,‹:°ü¹ÿÿÿÿò®÷ÑYÿƒÄøAPÿ2è#²‹Ð‹M ‹A,‰‹A,‹¡¾ü‰·Âüf‰D‹E€ ƒÄƒ½€ïÿÿÿ…ƃ=H©„©‹M ‹Q…ÒŽÛ‹…Ðïÿÿ=ÿÿÿÿ„Ê;ЌƒÄøƒÄôhàüèJ-ÿÿPjèZ1‹…Ðïÿÿ‹U ‰ÇB ‹M€ ƒÄ ‹…Ìïÿÿ…Àt ƒÄôPè.ÿÿƒÄƒ½œïÿÿtƒÄô‹…œïÿÿPèè-ÿÿƒÄƒÄô‹•ïÿÿRè%-ÿÿƒÄƒ=Ì©tƒÄø‹ïÿÿQhˆøèM3ƒÄƒ=`ut‹…ïÿÿ;huuè€éÿÿ¸)é3‹U ƒz$„³ƒÄü‹B,ÿ0ƒÄôh ýèv,ÿÿƒÄPjès2ƒÄ‹…Ìïÿÿ…ÀtƒÄôPèE-ÿÿƒÄƒ½œïÿÿtƒÄô‹œïÿÿQè(-ÿÿƒÄƒÄô‹…ïÿÿPèe,ÿÿƒÄƒ=Ì©tƒÄø‹•ïÿÿRhˆøè2ƒÄƒ=`ut‹ïÿÿ; huuèÀèÿÿ¸(és‹E Ç@é¡‹€ïÿÿ‹U ;J„Ž‹…Ìïÿÿ…Àt ƒÄôPè“,ÿÿƒÄƒ½œïÿÿtƒÄô‹…œïÿÿPèx,ÿÿƒÄƒÄô‹•ïÿÿRèµ+ÿÿƒÄƒ=Ì©tƒÄø‹ïÿÿQhˆøèÝ1ƒÄƒ=`ut‹…ïÿÿ;huuèèÿÿ¸/éËU ƒzt!‹…Ðïÿÿ=ÿÿÿÿt…€ïÿÿ‰…Ðïÿÿ뉅€ïÿÿ‹…Ðïÿÿ‹M ‰Aƒ=À¨„û‹Eö„ïƒ=Ä©…âƒÄøƒÄôhýè¼*ÿÿPjèÌ.‹…ÐïÿÿƒÄ =ÿÿÿÿtXƒÄøƒÄôPèX¾Pjè¨.ƒÄ ƒ½€ïÿÿÿtkƒÄüƒÄô‹…Ðïÿÿ+…€ïÿÿPè,¾PƒÄôh˜ýè^*ÿÿƒÄPjè[0ƒÄ ë5ƒÄøƒ=Ô¨t ƒÄôh¤ýë ƒÄôh“üè'*ÿÿƒÄPjè4.ƒÄ‹…Ìïÿÿ…ÀtƒÄüPh¬ýjè0ëƒÄøhûjè.ƒÄ‹…Ìïÿÿ…Àt ƒÄôPèÇ*ÿÿƒÄÇ…Ìïÿÿ‹U‹%=„‹M ÇÇA ƒ½œïÿÿtƒÄô‹…œïÿÿPè}*ÿÿƒÄƒÄô‹•ïÿÿRè¹)ÿÿƒÄƒ=Ì©tƒÄø‹ïÿÿQhˆøèá/ƒÄƒ=`u„Ô‹…ïÿÿ;hu…Âè æÿÿ鸡D©…À…ûƒÄô‹U ‹B,ÿ0èw•ƒÄƒ=Ø©tƒÄô‹M ‹A,ÿ0èw”ƒÄƒÄø¸¶ý‹U ƒzt¸³ýP‹M ‹A,ÿ0è˜*ÿÿ‹ØƒÄ…Û…ÖƒÄôÿ5ð­èý(ÿÿP‹U ‹B,ÿ0h¹ýjè .ƒÄ ƒÄô‹ïÿÿQèÆ(ÿÿƒÄƒ=Ì©tƒÄø‹…ïÿÿPhˆøèî.ƒÄƒ=`ut‹•ïÿÿ;huuè åÿÿƒ½œïÿÿtƒÄô‹œïÿÿQè)ÿÿ¸é»‹Ø‹E ƒxu0ƒ=ªu'ƒÄôSèC*ÿÿƒÄøjƒÄôSèE*ÿÿƒÄPèL*ÿÿ€c ÏƒÄ ƒ=È©tS‹•ˆïÿÿRj‹œïÿÿQè–+ÿÿƒÄ‹E  P‹…pïÿÿP•ðïÿÿR‹…Ðïÿÿ3Ò=ÿÿÿÿt‹ÐR‹M ÿqQS‹…ïÿÿPèNt‹U ‰B ƒÄ …À|aƒ½pïÿÿ…¤ƒÄô‹ïÿÿQè'ÿÿƒÄƒ=Ì©tƒÄø‹…ïÿÿPhˆøèÅ-ƒÄƒ=`utg‹•ïÿÿ;huuYèøãÿÿëRƒÄô‹ïÿÿQèI'ÿÿƒÄƒ=Ì©tƒÄø‹…ïÿÿPhˆøèq-ƒÄƒ=`ut‹•ïÿÿ;huuè¤ãÿÿƒ=D©u ƒÄôSè–(ÿÿë ƒÄôSè)ÿÿƒÄ=ÿÿÿÿu ‹M ÇA þÿÿÿƒ½œïÿÿtƒÄô‹…œïÿÿPèo'ÿÿ‹U ƒz þt¸*븥Hïÿÿ[^_ÉÃU‹ììüWVS‹]Ç…(ÿÿÿÇ…$ÿÿÿÇ…ÿÿÿÿÿÿÿ‹…ÿÿÿ‰…ÿÿÿÇ…ÿÿÿÇ…4ÿÿÿƒ=ªt(¡ª…Àtƒ=puuƒÄôPèCJÿÿÇpuƒÄ‹U ǃÄøj*‹uÿ6èF'ÿÿƒÄ…ÀtƒÄøƒÄôhàýè¯%ÿÿPjè¿)ƒÄ …Ût ƒ;t‰]üë4ƒÄô‹EPèЖ‰‰]üëƒÄô‹URè¼–‰…4ÿÿÿµ4ÿÿÿ‰uüƒÄ¡<©…Àu‹Eü‹‰… ÿÿÿ‹E‰Eø‹Eü‹‹ú°ü¹ÿÿÿÿò®÷ÑqÿA$ð+à‹Üƒ=ü¨„ˆƒÄôRè㭃ąÀtxƒÄü‹Eüÿ0ƒÄôh þè÷$ÿÿƒÄPjèô*‹U€ ƒÄô‹Eüÿ0èe²‹ÐƒÄ …Ò„¤ ¿Mþ¹‹ðü¨ó¦t‹ò¿Rþ¹ü¨ó¦…z ‹E€éo Ç…,ÿÿÿƒ=Щ„¸Æ…ÿÿÿƒ=Ô©tG‹EüƒÄüVÿ0Sè^%ÿÿ¡Vþ‰·Zþf‰DƒÄø…HÿÿÿPSèº&ÿÿƒÄ …Àu Æ…ÿÿÿ‰$ÿÿÿ€½ÿÿÿu&ƒÄø…HÿÿÿP‹Eüÿ0è‰&ÿÿƒÄ…Àu ‹Eü‹‰…$ÿÿÿƒ½$ÿÿÿt)Ç…,ÿÿÿ‹Uˆ‰•ÿÿÿ‹µxÿÿÿ‰µÿÿÿÇ…(ÿÿÿÇ…0ÿÿÿ‹EÇUЉ• ÿÿÿÿ…0ÿÿÿƒÄô‹µ0ÿÿÿVèw|ƒÄôj蹩‹ðƒÄ ƒ=À¨„ƒÄøj‹EPè­š‹øº\þ¡\þ‰…8ÿÿÿ‹B‰…<ÿÿÿŠBˆ…@ÿÿÿƒÄ8ÿÿÿƒ½0ÿÿÿ~$ƒÄü‹•0ÿÿÿRƒÄôheþè#ÿÿƒÄPSè"%ÿÿƒÄƒÄø‹… ÿÿÿPSWVhoþjèþ(ƒÄ ƒÄôWèÚ#ÿÿƒÄƒ=©uƒ½,ÿÿÿtƒ½(ÿÿÿu‹U€ ë‹u€&ûÇE؃½0ÿÿÿ~‹Eöu ƒ=H©tNƒÄô‹• ÿÿÿRè^«ƒÄ…Àt8ƒÄø…HÿÿÿP‹µ ÿÿÿVèñ$ÿÿƒÄ…Àu‹…\ÿÿÿ%ð=€u ‹…xÿÿÿ‰EØÇEôƒ=H©t ƒ}ØtÇEôƒ}t ƒ½0ÿÿÿ ƒ=t©u ‹E€ë‹U€"÷‹uV‹EP‹• ÿÿÿR‹uVèáÿÿ‹ØƒÄ¡<©…Àu‹Eü‹‰… ÿÿÿƒÄôjèÿ§‹ðƒÄ‹Eà…ÀtƒÄôPè^¦‹U ‰ƒÄCÿ=9‡Xÿ$…lƒÄô‹µ ÿÿÿVèYàÿÿƒÄøÿ5Ȩ‹…0ÿÿÿPè|yéhƒÄô‹• ÿÿÿRéƒÄøhûjèi%ƒÄôÿ5ð­è“!ÿÿP‹Eüÿ0ƒÄôhˆþè0!ÿÿƒÄPjè-'ƒÄ0ƒÄô‹µ ÿÿÿVë6ƒÄøhûjè%ƒÄøƒÄôhÀþèõ ÿÿPjèõ&ƒÄ0ƒÄô‹… ÿÿÿPè§ßÿÿƒÄ‹…4ÿÿÿ…Àt ƒÄôPèµ!ÿÿ‹ÃéÓƒ}àu&ƒÄüÿuìƒÄôhÿè£ ÿÿƒÄPjè &éǃÄô‹µ ÿÿÿVèMßÿÿƒÄ‹…4ÿÿÿ…Àt ƒÄôPè[!ÿÿ¸étƒÄô‹… ÿÿÿPéè—!ÿÿ‹Uö… ƒ=À¨u/ƒÄøj‹EPèe—‹ØƒÄüSh+ÿjè&ƒÄ ƒÄôSèó ÿÿƒÄƒÄôÿuèÿuìVƒÄôh0ÿèéÿÿƒÄPjèæ%ƒÄ ƒÄøhûjèä#ƒÄô‹• ÿÿÿRè‰ÞÿÿƒÄ ‹…4ÿÿÿ…Àt ƒÄôPè— ÿÿ¸%é°ƒ½(ÿÿÿubƒ=Щt‹Eä…ÀuƒÄøƒÄôh`ÿèoÿÿPjë5‹Eä…Àt4ƒÄôPèl‰…ÿÿÿƒÄ=ÿÿÿÿuƒÄøƒÄôh ÿè8ÿÿPjèH#ƒÄ ƒ½,ÿÿÿ„ôÇ…(ÿÿÿ‹u€&ûÇ…,ÿÿÿÇ…0ÿÿÿƒ}ä„­ƒ½ÿÿÿÿ„ ‹…ÿÿÿ9…ÿÿÿ|w‹EÔ=ÿÿÿÿt9…ÿÿÿu=ƒÄü‹•$ÿÿÿRƒÄôhàÿè®ÿÿƒÄPjè«$ƒÄô‹µ ÿÿÿVè`ÝÿÿƒÄ édƒÄü‹…ÿÿÿPƒÄôh èqÿÿƒÄPjèn$ƒÄëƒÄøƒÄôh`èPÿÿPjè`"ƒÄ ƒÄô‹• ÿÿÿRèÝÿÿƒÄé&ƒ½ÿÿÿÿtcƒ=©uc‹UЋEÔ;Ðtƒ}ÜuJ=ÿÿÿÿt ;Ð|?ƒ=Шu63À‹<©…Òtƒ=@©t ‹Âë‹Eü‹…ÀtƒÄø‹•ÿÿÿRP该ƒÄƒ=©tÿuèÿuìhƒjè­#ésƒÄüjÿuð‹EØ‹UÐ+ЋÂPètl‹Ø‹UЋEÔƒÄ;Ð…©‹UötRƒÄüPP‹… ÿÿÿPSVƒÄôh èNÿÿƒÄPjèK#ƒÄ ‹•0ÿÿÿR‹… ÿÿÿPÿuÔÿuЋUÿ2Vhàjè"#ƒÄ ÿÀ©ƒÄôÿuÐèBuƒÄ‹uö tƒÄø‹… ÿÿÿPjë ƒÄø‹• ÿÿÿRjèÓŸƒÄƒÄô‹µ ÿÿÿVé—ƒ}Ü…þ=ÿÿÿÿ…‹‹EötQƒÄøR‹• ÿÿÿRSVƒÄôhè‘ÿÿƒÄPjèŽ"ƒÄ ƒÄü‹…0ÿÿÿP‹• ÿÿÿRÿuЋEÿ0Vhjèe"ƒÄ ÿÀ©ƒÄôÿuÐè…tƒÄ‹Uö „êƒÄø‹µ ÿÿÿVjéå;Ð}HƒÄôRSVƒÄôh@èÿÿƒÄPjè"ƒÄ ƒÄøÿ5Ȩ‹µ0ÿÿÿVèòsƒÄô‹… ÿÿÿPéσ=Ш…ǃÄüPR‹• ÿÿÿRSVƒÄôh€è´ÿÿƒÄPjè±!ƒÄ ‹…0ÿÿÿP‹• ÿÿÿRÿuÔÿuЋEÿ0Vhàjèˆ!ÿÀ©ƒÄ ƒÄôÿuÐè¨sƒÄ‹Uö tƒÄø‹µ ÿÿÿVjëƒÄø‹… ÿÿÿPjè7žƒÄƒÄô‹• ÿÿÿRèùÙÿÿƒÄ‹…4ÿÿÿ…Àt ƒÄôPèÿÿ¸"é!ƒÄøPRSVƒÄôhÀèôÿÿƒÄPjèñ ƒÄ ƒÄøÿ5Ȩ‹µ0ÿÿÿVèÕrƒÄô‹… ÿÿÿPé²=ÿÿÿÿuUƒÄøƒÄôÿ5ð­èøÿÿPÿuÐSVƒÄôhè•ÿÿƒÄPjè’ ƒÄ0ƒÄøÿ5Ȩ‹•0ÿÿÿRèvrƒÄô‹µ ÿÿÿVëVƒÄüƒÄôÿ5ð­è£ÿÿPÿuÔÿuÐSVƒÄôh@è=ÿÿƒÄPjè: ƒÄ0ƒÄøÿ5Ȩ‹…0ÿÿÿPèrƒÄô‹• ÿÿÿRè×ØÿÿƒÄ ¡È¨…À„Söÿÿ9…0ÿÿÿŒGöÿÿ¸,¥øþÿÿ[^_ÉÃU‹ìƒìS‹]ƒÄôSèÙÿÿ‰EüƒÄ=ÿÿÿÿu!ÿKƒÄôSèÀÿÿ‰EüƒÄ‹ÐƒúÿtP‰EüƒÄôEüPèoÿÿ‹ØÇC ƒÄôSèÿÿ‹ÐƒÄ ƒúÿuÿKƒÄôSèwÿÿ‹Ðƒúÿt ‹EüÀ+‹]èÉÃU‹ìS‹U…ÒtM¶¹à8‹ÙöA@t B¶öA@uöŠ„Àt"u¸ÿÿÿÿë3‹U‹…ÀtƒÄôPènÿÿƒÄƒÄøVSèš›‹U‰+uFë3Àeè[^_ÉÃU‹ìWVS‹M‹] ¿‹ñAŠÀèPW< wP0ˆ‹ñAŠ$PW< wP0ˆCOyÕÆ[^_ÉÃU‹ììœWVSÇ|uÇxuÇtu‹]ƒÃ€;„­ƒÄôS蟲ÿÿØ3ÿƒÄ3öƒÄüÿ¶kÿ¶kSèsþÿÿƒÄ…À} ¡tuéš…ÀtØë ƒÆGƒÿvǃÿu?ëCŠ„ÀtO<=uõ€;tFC€;t@ƒÄôSè5²ÿÿ؃Ä€;"uCŠ„Àt#<"uõ€;tCŠ„Àt<,uõ€;t C€;…Vÿÿÿ¡tu…Àt1ƒ=|utƒ} tƒ}t ƒ}tƒ}uD…Àt ƒÄôPèßÿÿƒÄ¡xu…ÀtƒÄôPèÊÿÿƒÄ¡|u…Àt ƒÄôPè²ÿÿ3ÀéðèË.$ð+à‹ÜƒÄôSèÃ.ƒÄüS‹} °ü¹ÿÿÿÿò®÷ÑAÿP‹U Rè·.ƒÄ ƒÄüSjh»è¤.ƒÄüS‹tu‹ú°ü¹ÿÿÿÿò®÷ÑAÿPRè‚.ƒÄ ƒÄüSjh»èo.ƒÄüS‹}°ü¹ÿÿÿÿò®÷ÑAÿP‹URèO.ƒÄ ƒÄøuðVSè[.ƒÄøVM̉M€Qè£ýÿÿƒÄ ƒÄôSè.ƒÄüS‹}°ü¹ÿÿÿÿò®÷ÑAÿP‹URè.ƒÄ ƒÄüSjh»èð-ƒÄüS‹}°ü¹ÿÿÿÿò®÷ÑAÿP‹URèÐ-ƒÄ ƒÄøVSèß-ƒÄøVM¨‰|ÿÿÿQè$ýÿÿƒÄ ƒÄôSè-ƒÄüSj ‹}€Wè•-ƒÄ ƒÄüSjh»è‚-ƒÄüS‹|u‰•xÿÿÿ‹ú°ü¹ÿÿÿÿò®÷ÑAÿPRèZ-ƒÄ ƒÄüSjh»èG-ƒÄüSj ‹…|ÿÿÿPè5-ƒÄ ƒÄøVSèD-ƒÄøV]„SèüÿÿƒÄ ƒÄô‹} °ü¹ÿÿÿÿò®‹ñ÷Ö‹} ü¹ÿÿÿÿò®÷щxÿÿÿ‹=tuü¹ÿÿÿÿò®‹Ñ+ò‹=|uü¹ÿÿÿÿò®‹Ñ)•xÿÿÿ‹}ü¹ÿÿÿÿò®‹Ñ+ò‹½xÿÿÿD7øP ‹=xu…ÿt°ü¹ÿÿÿÿò®÷ÑD ë Pèy–‹ðƒÄüS‹URÿ5|uÿ5tu‹M QhÀVè8ÿÿƒÄ0ƒ=xutC‹þ°ü¹ÿÿÿÿò®÷Ñ\ÿƒÄøhSèLÿÿƒÄøÿ5xuSè=ÿÿƒÄ ƒÄøh Sè,ÿÿƒÄƒÄøh"Vèÿÿ‹Æ¥Xÿÿÿ[^_ÉÃU‹ìƒìVS‹]3öƒÄüjh€üSèÏÿÿƒÄ…Àu¶CöEà8@uY€{tSƒÄüjh%Sè¤ÿÿƒÄ…Àu¶CöEà8@u.€{t(ƒÄüjh,Sèyÿÿ…Àu¶CöEà8@u€{u¾‹Æeè[^ÉÃU‹ìƒì WVS‹u‹}3ÛƒÄüjh€üVè/ÿÿƒÄ…ÀuƒÄüh¶ùW‹E Pèîøÿÿ‹ØƒÄƒÄüjh,VèÿÿƒÄ…ÀuƒÄüh¶ùW‹E PèÀøÿÿë-ƒÄüjh%VèÔÿÿƒÄ…ÀuƒÄôÿuÿuW‹E PVè}úÿÿ‹Ø‹Ãeè[^_ÉÃU‹ìƒì¡du…Àt ƒÄôPèh¯ÿÿÉÃU‹ìƒì WVS3ÿ¾R>‹ÐÁêÑûƒÄø[ÿ4…k‹EPèÿÿƒÄ…Àu‹Ãë…À}sÿë{;þ~½¸ÿÿÿÿeè[^_ÉÃU‹ìƒìW¿À¨3Àü¹Wó«ÇªÇÀ¨ÿÿÿÿƒÄôh{èm”£©ÇȨÇè¨Çø¨ƒÄôh}è=”£L©ƒÄ ƒÄôh‡è(”£P©ÇT©ÇX©Çì©Çl©Çp©ƒÄôhŽè ÿÿƒÄ …ÀtƒÄôPè””£„©Çt©Ç˜©„Ǩ©Çè©Çô©Çü© Çø©2‹}èÉÃU‹ìƒìƒÄôh—è-ÿÿƒÄ…Àu"ƒÄôè¾ÿÿPèÈÿÿƒÄ…Àt‹@…Àu3Àë ƒÄôPè?“ÉÃU‹ìƒìWS3ÿƒÄôhœèáÿÿ‹ØƒÄ…ÛtX€;tSƒÄôSè:—ƒÄ…Àu7ƒÄôƒÄôÿ5ð­è¢ÿÿPSÿ5$ªh£hPªè+ÿÿƒÄ0ƒÄôjèÞ ÿÿƒÄôSèÇ’ëlè;ÿÿÿ‹Ø…Ût=ƒÄô‹û°ü¹ÿÿÿÿò®÷ÑAPè'’‹øƒÄüSh°WèúÿÿƒÄ ƒÄôSèÎÿÿƒÄ…ÿtƒÄôWè›–ƒÄ…Àt‹Çë ƒÄôWè§ÿÿ3Àeè[_ÉÃU‹ìƒìWVSƒÄøh»‹EPèbÿÿ‰EôƒÄ…Àu@ƒÄôƒÄôÿ5ð­èÇ ÿÿP‹EPÿ5$ªƒÄôh¾è_ ÿÿƒÄPhPªèAÿÿéüÇ€u¿鵃ÄüEüPEøPSèk‹ðƒÄôSèÿÿƒÄ ƒþu\ƒÄøÿuüÿuø较ąÀu,ƒÄôW‹EPÿ5$ªƒÄôhØèÜ ÿÿƒÄPhPªè¾ÿÿƒÄ ƒÄôÿuøè° ÿÿƒÄôÿuüè¥ ÿÿë0…öu,ƒÄôW‹EPÿ5$ªƒÄôhØè‘ ÿÿƒÄPhPªèsÿÿƒÄ GƒÄô‹EôPèCš‹ØƒÄ…Û…6ÿÿÿÇ€uƒÄô‹EôPè0ÿÿeØ[^_ÉÃU‹ìƒì WVSè:üÿÿƒÄôhõèý”ƒÄ…ÀtƒÄôhõèmþÿÿƒÄèyýÿÿ‹Ø…ÛtL‹ó¿õ¹ü¨ó¦u$Sÿ5$ªƒÄôh èä ÿÿƒÄPhPªèÆ ÿÿë ƒÄôSèþÿÿƒÄƒÄôSè¯ ÿÿeè[^_ÉÃU‹ìƒì WVS‹]€;t-¶ºà8‹òöB@tC€;t¶öB@uñŠ„Òt€ú#u¸ÿÿÿÿé#‹û¶öFˆt C¶öFˆuöŠ€ú_tï€ú-tê¶öF@u €ú=t3ÀéèƒÄô‹Ã+Ç@PèN‹U ‰ƒÄ;ûsŠ€ú_t€ú-tˆ@G;ûrìƃÄô‹E ÿ0èúÿÿƒÄ=ÿÿÿÿu ƒÄô‹U ÿ2ë#¶öF@t ‹ÖC¶öB@uö€;=tƒÄô‹E ÿ0è¤ ÿÿ3ÀëgC¶öF@t ‹ÖC¶öB@uö‹}°ü¹ÿÿÿÿò®÷Ñ‹UD ÿPÿ;Óv¶@ÿöF@tJ;Óv ¶öF@uòƒÄøBPSè‹Ð‹E‰¸eè[^_ÉÃU‹ìƒìVS‹]‹u …ÛtX…ötTƒÄôSèÁùÿÿƒÄ=ÿÿÿÿtƒÄü@Áàÿ°kVS‹€ kÿÐë(ƒÄôVSÿ5$ªƒÄôh`èä ÿÿƒÄPhPªèÆ ÿÿ3Àeè[^ÉÃU‹ìƒìWVS‹} ‹uÇEðÇEôÇEøÇEüƒÄøjW躩ÿÿ‹ØƒÄ…Ûu-ƒÄôWÿuÿ5$ªƒÄôh ès ÿÿƒÄPhPªèU ÿÿ3ÀëgƒÄüEôPjS蕦ÿÿƒÄôSèL¨ÿÿfÇEðfÇEòƒÄ ‹…ÀtƒÄôPè ÿÿƒÄƒÄôjèF‹Ð‰‹Eð‰‹Eô‰B‹Eø‰B‹Eü‰B ¸eØ[^_ÉÃU‹ìƒìS‹] ƒÄøhÏSè8 ÿÿƒÄ…Àt €;1u€{u ºëOƒÄøhÒSè ÿÿƒÄ…Àt €;0u €{u3Òë(ÿuÿ5$ªƒÄôhàè‚ÿÿƒÄPhPªèd ÿÿ3Àë ‹E‰¸‹]èÉÃU‹ìƒìVS‹] ‹u‹=ÿÿÿÿ„ß=„ÔƒÄøh SèŒ ÿÿƒÄ…Àt €;2u€{u¸騃ÄøhÏSè^ ÿÿƒÄ…Àt €;1u€{u¸ë}ƒÄøhÒSè6 ÿÿƒÄ…Àt €;0u €{u3ÀëXƒÄøh Sè ÿÿƒÄ…Àt€;-u€{1u€{u ¸ÿÿÿÿë+ÿuÿ5$ªƒÄôh èzÿÿƒÄPhPªè\ ÿÿ3À뉸eè[^ÉÃU‹ìƒìS‹] ƒÄôS蹋Ѓăúÿt‹E‰¸ë-ƒÄôSÿuÿ5$ªƒÄôh` èÿÿƒÄPhPªèôÿÿ3À‹]èÉÃU‹ìƒìVS‹u ‹]ƒÄøh… Vè@ÿÿƒÄ…ÀtƒÄüSVÿuètÿÿÿë Ǹeè[^ÉÃU‹ìƒìS‹]‹…Àt ƒÄôPè‹ÿÿƒÄƒÄôÿu è1‹‰¸‹]èÉÃU‹ìƒìWVS‹u ‹E‰Eü‹…Àt ƒÄôPèOÿÿƒÄƒ=€ut €>~u€~/tƒÄôVè㊋Uü‰é—èO÷ÿÿ‰Eø…Àtà‹ø°ü¹ÿÿÿÿò®÷ÑYÿF…Ût‹Uø€|ÿ/uK‹UøÆ…Ût€|ÿ/tí‹ð€>/uF€>/túƒÄô‹þ°ü¹ÿÿÿÿò®÷ÑPèô‰‹øƒÄüS‹UøRWè¸ÿÿÆ;/ƒÄ ƒÄøVD;PèÃÿÿ‹Eü‰8¸eØ[^_ÉÃU‹ìƒìS‹E ‹]€8tƒÄøƒÄôPèÖŠPÿ3èò•‰ëƒÄôÿ3袕Ǹ‹]èÉÃU‹ìƒìWVS‹E ‹U‰Uü€8teƒÄôP茊‹ð‹ÞƒÄ…öt9ƒ>t4‹‰Eø‹ø°ü¹ÿÿÿÿò®÷ÑQÿƒú~‹Eø€|ÿ/uÆDÿƒÃtƒ;ũÄøV‹Uüÿ2è^•‹Uü‰ëƒÄô‹Eüÿ0è•‹UüǸeØ[^_ÉÃU‹ìƒì WVS‹u ‹E‰Eü3ۋ΀>iu€~nu€~fu €~„²€>t3¾‹Â%ÿ¿à8öGt›\BÐA€9t¾‹Â%ÿöGuã;ÎtO€9t€yuD¶¶€à:=kt …ÀtQ=gtë$=mt ëÁã ë7Áãë/Áãë'ƒÄüV‹EPƒÄôh  è×ÿÿƒÄPèîÿÿ3Àë ‹Eü‰¸eè[^_ÉÃU‹ìƒì WVS‹}‹u 3ҋ΀>t)¶»à8öCt’¾TPÐA€9t ¶öCuç;΄—€9t €y…ˆ¶¶€à:=ht3…À„=dt6ëd=mt =wt>ëT‹ÂÁà+Â…ëdÕ+ÂÁàÐÁâëQ’‚ÂÁà+‹ÐÁâë;’‹ÂÁà+‹ÐÁâ+ÐÁâë"ƒÄüVWƒÄôh  èÂÿÿƒÄPèÙÿÿ3Àë ‹E‰¸eè[^_ÉÃU‹ìƒìƒÄühì¨ÿu ÿuè—ùÿÿ…Àu3Àë*ƒ=ì¨tÇð¨ë Çð¨¸ÉÃU‹ìƒì WVS‹u €>u#¡h©…Àt ƒÄôPèÿÿÇh©鿃ÄôVèçƒÄ…Àu0ƒÄôVÿuÿ5$ªƒÄôh` èòÿÿƒÄPhPªèÔÿÿ3Àé„‹h©…Òt‹ú°ü¹ÿÿÿÿò®÷ÑYÿë3ÛƒÄø‹þ°ü¹ÿÿÿÿò®÷ÑD PRèú…£h©ƒÄøVÃPè­ÿÿ‹þ°ü¹ÿÿÿÿò®÷Ñ\ ÿ¡h©Æ C¡h©Æ ¡h©ÆD¸eè[^_ÉÃU‹ìƒìƒÄühì©ÿu ÿuèGøÿÿ…Àtƒ=ì©u Çè©ÉÃU‹ìƒìƒÄüEüPÿu ÿuèøÿÿ…Àu3ÀëFƒ}üt;Çبƒ=ð¨u Çì¨ÇЩÇè¨ÿÿÿÿÇ詸ÉÃU‹ìƒìS‹] ƒÄôSè¥!ƒÄ…Àu.ƒÄôSÿuÿ5$ªƒÄôhÀ è€ÿÿƒÄPhPªèbÿÿ3Àë-¡Œ©…ÀtƒÄôPèJÿÿƒÄƒÄôSèï„£Œ©¸‹]èÉÃU‹ìƒìƒÄühبÿu ÿuè3÷ÿÿ…Àu3Àë$ƒ=بtƒ=ð¨u Ç쨸ÉÃU‹ìƒìS‹] €;tƒÄøj SèZÿÿƒÄ…Àt/ƒÄôSÿuÿ5$ªƒÄôh` è¹ÿþÿƒÄPhPªè›ÿÿ3ÀëƒÄôSè?„£Ü©¸‹]èÉÃU‹ìWVS‹U‹ú3Û€:t8¾ ‹Á%ÿ¾à8öFt›\AÐB€:t¾ ‹Á%ÿöFuã€:u;úu ¸ÿÿÿÿë‹Ã[^_ÉÃU‹ìƒìS‹]‹ÓŠ„Àt&<:t'¶¹à8öA@uBŠ„Àt <:t¶öA@tì€::u;ÓtƒÄøj Sè`ÿÿ…Àu¸ë3À‹]èÉÃU‹ìƒì¡D©…Àt ƒÄôPè”ÿÿÉÃU‹ìƒìS‹UÒÁà+Â…‹ƒ$v…ÀtƒÄôPètÿþÿǃ$vǃ(v‹]èÉÃU‹ìƒìWVS‹E ‰Eü‹U)Uü„éƒ=À‚…¡o=ÿÿÿÿu Çoë ƒÄôPèoÿÿÿƒÄ‹oÒÁà+Â4…ž u}ü€~$ƒÄø‹E P‹UR胉†$v‰†(vé8ƒÄü‹EüP‹URSèÃþþÿ‹EüƉž(vé‹oÒÁà+ÂÁà‰Eø‹ðÆ u‹$v…ÒtR‹ú°ü¹ÿÿÿÿò®÷ÑYÿƒÄø‹Eü4FPRè‹Uø‰‚$v؃Äü‹EüP‹URSèJþþÿ‹Uø‹‚$vÆël‹þ°ü¹ÿÿÿÿò®÷ÑYÿ‹Uü<ÿ€~YƒÄôGPè9‹Uø‰‚$vƒÄüSVPèùýþÿ‹Eø˜$vƒÄ ƒÄü‹UüR‹EPSèÜýþÿ‹Uø‹‚$vÆ‹‚$v‰‚(vë"3ƒÄü‹UüR‹URPè¬ýþÿÆ7‹Eø‰°(v‹U €zÿ •À%ÿ£À‚…Àu#¡oP‰o‹Â=~ ÇoeØ[^_ÉÃU‹ìƒìWS‹]€;t=ƒÄøj SèÁýþÿ‹øƒÄ…ÿu‹û°ü¹ÿÿÿÿò®÷Ñ| ÿëGƒÄøWSè±ýÿÿ‹ßƒÄ€;uÃeè[_ÉÃU‹ìƒ=Ä‚t3Àë¡È‚…Àu¸PªÉÃU‹ìƒìVS‹]‹u èåèÈÿÿÿ…Àtfƒûtrƒûuƒ=À¨uQƒ=ĨuHë ƒ=À¨t=ƒÄøPVè™ýþÿƒÄƒ=Ì‚t ƒÄôVè(ÿÿÿƒÄƒ=üntèÿë ÇЂeè[^ÉÃU‹ììŒWVS‹u]€¿€è8ÿÿÿ‰…|ÿÿÿƒ=Ì‚uƒÄü‹EP‹E P‹…|ÿÿÿPèJÿþÿës‹F…Àt‹‹ø‹EP‹E PWSè>ÿþÿƒÄ=ÿÿÿÿu?ë ;Ç|XƒÄøSÿ6è6‰‰^3ÀëPƒÄôSèkþÿÿƒÄø‹…|ÿÿÿPSè·üþÿƒÄ ‹…Àt ƒÄôPè•ûþÿƒÄƒ=ünt è ë ÇЂ¸¥hÿÿÿ[^_ÉÃU‹ìƒìèaþÿÿ…Àt ƒÄôPèÌüþÿÇЂÉÃU‹ìƒì‹E;ünt+…ÀuÇünëƒ=ЂtèªÿÿÿÇünÉÃU‹ì‹E‹Ì‚£Ì‚‹ÂÉÃU‹ìƒìS‹]èùƒ=Ä‚u`ƒûtrƒûu!ƒ=À¨uKƒ=Ĩu?ë ƒ=À¨t3ÇEôÇEøÇEü]ôEƒÄüPÿpüSè,þÿÿƒÄ…Àté‹]èÉÃU‹ìƒì VSƒ=Ì©t?èrƒ=Ä‚u1ÇEôÇEøÇEüuô] ƒÄüSÿsüVèÓýÿÿƒÄ…ÀtìeØ[^ÉÃU‹ìƒì‹U…Òt?ƒÄø¸ ƒ} t¸ PRèÉúþÿ£È‚ƒÄ…ÀuGƒÄôÿ5©è/ýþÿƒÄôjè…øþÿÇÈ‚PªƒÄôƒÄôhPªè ûþÿPèýþÿ…Àt ÇÌ‚ÉÃU‹ìƒìS¡È‚…Àt ƒÄôPèkúþÿƒÄÇÈ‚ÇÄ‚ÇÌ‚3ÛƒÄôSè¯ùÿÿƒÄCƒû~îÇoÿÿÿÿÇÀ‚‹]èÉÃU‹ìƒìVS‹oè!üÿÿ‹ð…ötyƒûÿttƒ=À‚t Cƒû~3ÛÛÁà+Ë…(v…Àt ƒÄøVPèïùþÿƒÄCƒû~3Û;ouЃ=À‚t ÛÁà+Ë…(v…Àt ƒÄøVPè¶ùþÿƒÄƒÄôVèúþÿeè[^ÉÃU‹ìƒìSƒÄôh è8‹ØSÿ5Ô‚ƒÄôh èv÷þÿƒÄPhPªèXùþÿƒÄ ƒÄøh Sè'ùþÿ£È‚ƒÄ…Àu;ƒÄôÿ5ð­è÷þÿPSƒÄôhK è.÷þÿƒÄPhPªèùþÿÇÄ‚ƒÄ ëèÏþÿÿƒÄôSèò÷þÿÇÌ‚‹]èÉÃU‹ìƒìƒ=ouÇoè2ÿÿÿÉÃU‹ìƒ=ouƒ=Ì‚t Ço‹E£Ô‚ÉÃU‹ìƒìƒÄøh€ jèÿúþÿƒÄøh€ jèðúþÿƒÄ ƒÄøh h— èëúþÿƒÄôh— èîúþÿÉÃU‹ìƒìƒÄøÿ5$ªƒÄôh  è@öþÿƒÄPèWúþÿÉÃU‹ìƒìƒÄøÿ5¤tƒÄôhÀ èöþÿƒÄPè/úþÿè®ÿÿÿƒÄøh@ªƒÄôh èõõþÿƒÄPèì÷þÿƒÄ ƒÄøh@ªƒÄôh` èÔõþÿƒÄPèË÷þÿƒÄøh@ªƒÄôh` è¶õþÿƒÄPè­÷þÿƒÄ ƒÄøh@ªƒÄôh`è•õþÿƒÄPèŒ÷þÿƒÄøh@ªƒÄôhÀèwõþÿƒÄPèn÷þÿƒÄ ƒÄøh@ªƒÄôh èVõþÿƒÄPèM÷þÿƒÄøh@ªƒÄôh è8õþÿƒÄPè/÷þÿƒÄ ƒÄøh@ªƒÄôh@èõþÿƒÄPè÷þÿƒÄøh@ªƒÄôh`èùôþÿƒÄPèðöþÿƒÄ ƒÄøh@ªƒÄôh èØôþÿƒÄPèÏöþÿÉÃU‹ìì¼WVS‹uèþÿÿÇ…XÿÿÿƒÄøj/‹E ÿ0è_øþÿ£$ªƒÄ…Àu‹U ‹ë@£$ªè9èÿÿé4Áÿÿÿ=f‡ ÿ$…è)ƒÄøhä#h"鼃Äøhä#hç#騃Äøhä#hð#锃Äøhä#hü#逃Äøhä#h $élƒÄøhä#h$éXƒÄøhä#h!$éDƒÄøhä#h+$é0ƒÄøÿ5àhh5$éƒÄøh=$hï!éƒÄøh=$hA$éôƒÄøh=$hK$éàƒÄøh=$hV$é̃Äøÿ5àhhd$é·ƒÄøh=$hp$餃Äøhä#h~$éƒÄøhä#h“#é|ƒÄøhä#hy#éhƒÄøhä#he#éTƒÄøhä#h‰$é@ƒÄøhä#h—$é,ƒÄøhä#h¡$éèoüÿÿƒÄôjèIòþÿƒÄøhä#h«$éôƒÄøhä#h»$éàƒÄøhä#hÈ$é̃Äøhä#hè"鸃Äøhä#h÷!餃Äøhä#hÕ$éƒÄøhä#hä$é|ƒÄøhä#hó$éhƒÄøhä#h`"éTƒÄøhä#hJ"é@ƒÄøÿ5¤thÿ$èÝõþÿƒÄøƒÄôh %è­ñþÿPhq%èÂõþÿƒÄ0ƒÄøƒÄôh€%èñþÿPhq%è¤õþÿƒÄ ƒÄôƒÄôh€&èqñþÿPè‹õþÿƒÄ ƒÄôjèñþÿƒÄøhä#hï!鸃Äøhä#hA$餃Äøÿ5àhh¿&éƒÄøÿ5àhhÈ&é{ƒÄøÿ5àhh:!égƒÄøÿ5àhhÓ&éSƒÄøÿ5àhh2!é?ƒÄøÿ5àhhÜ&é+ƒÄøÿ5àhhë&éƒÄøÿ5àhhõ&éƒÄøÿ5àhhÊ!éïƒÄøÿ5àhh9 éÛƒÄøÿ5àhh'éǃÄøÿ5àhhª!鳃Äøÿ5àhh '韃Äøÿ5àhh'鋃Äøÿ5àhh« éwƒÄøÿ5àhh$'écƒÄøÿ5àhhR éOƒÄøÿ5àhhà!é;ƒÄøÿ5àhh.'èyåÿÿÇ…XÿÿÿƒÄé_ƒÄøÿ5àhhÅ!éÿƒÄøÿ5àhh²!éëƒÄøÿ5àhhˆ!é׃Äü…tÿÿÿP…pÿÿÿPÿ5àhè˜ãÿÿƒÄ…Àt%ƒÄøÿµtÿÿÿÿµpÿÿÿèñäÿÿƒÄ…Àu>ƒÄôjèÐîþÿÿ5àhÿ5$ªƒÄôh6'èïþÿƒÄPhPªèéðþÿƒÄôjèŸîþÿƒÄôÿµpÿÿÿèÎïþÿƒÄôÿµtÿÿÿèÀïþÿƒÄ 逃Äøÿ5àhhO'éƒÄøÿ5àhhA!é ƒÄøÿ5àhhZ'é÷ƒÄøÿ5àhhm'éãƒÄøÿ5àhhs'éÏ‹àh€;„ Š¸¾À=.‡‚ÿ$…„+ƒÄøh=$hï!ë^ƒÄøh=$hK$ëNƒÄøh=$hA$ë>ƒÄøhä#h!$ë.ƒÄøh=$hV$ëƒÄøhä#hç#ëƒÄøh=$hp$è‚ãÿÿƒÄëeƒÄü¾Pÿ5$ªƒÄôh|'è¢íþÿƒÄPè¹ñþÿè8÷ÿÿƒÄôhš'è§ñþÿƒÄ ƒÄøÿ5$ªƒÄôh 'èníþÿƒÄPè…ñþÿƒÄôjè íþÿC€;…þþÿÿéƒÄøÿ5àhhÃ'飃Äøÿ5àhh.'éƒÄøÿ5àhhÒ'ë~ƒÄøÿ5àhh‡ ënƒÄøÿ5àhh€ ë^ƒÄøÿ5àhhk ëNƒÄøÿ5àhhe ë>ƒÄøÿ5àhhÜ'ë.ƒÄøÿ5àhhC ëƒÄøÿ5àhhæ'ëƒÄøÿ5àhhù'èMâÿÿƒÄë@è'öÿÿƒÄôhš'è–ðþÿƒÄøÿ5$ªƒÄôh 'è`ìþÿƒÄPèwðþÿƒÄ ƒÄôjèúëþÿƒÄôjhoh #‹E PVè€ÿÿƒÄ =ÿÿÿÿ…©÷ÿÿƒ=è¨u£è¨ƒ=ªt0ƒ=بu'ÇبÇ訃=ð¨u Ç쨃=À¨ÿuƒ=Ĩ”À‹Ðƒâ‰À¨ƒ=À¨t3ƒ=Ĩt*ƒÄôƒÄôh (èšëþÿPè´ïþÿƒÄ è0õÿÿƒÄôjè2ëþÿƒ=Щt3ƒ=ü¨t*ƒÄôƒÄôh`(è^ëþÿPèxïþÿƒÄ èôôÿÿƒÄôjèöêþÿ‹þ+=ähufƒ=©u]ƒÄøÿ5$ªƒÄôh(èëþÿƒÄPè2ïþÿè±ôÿÿƒÄôhš'è ïþÿƒÄ ƒÄøÿ5$ªƒÄôh 'èçêþÿƒÄPèþîþÿƒÄôjè„êþÿƒ=̨tè¾qƒ=À¨tƒÄôÿ5Œ©è' ƒÄ½$ð+à‹ô3Û;ß}EƒÄô¡äh‹U ÿ4‚èÉJƒÄ…Àt‰žëƒÄô¡äh‹U ÿ4‚è o‰žƒÄCÿäh;ß|¼ÇžƒÄø‹…XÿÿÿPÿ5©èñÿÿƒÄƒ=Ì©tƒÄüh®(ÿ5¤thÀ(èœðÿÿƒÄ¡<©…À„›€8-u€xuÇD©@ªéƒÄøºì(ƒ=H©tºé(RPè›ëþÿ‹Ð‰D©ƒÄ…ÒuƒÄôÿ5<©èþíþÿƒÄôjèTéþÿƒÄø…xÿÿÿPƒÄôRèáëþÿƒÄPè(îþÿƒÄ…Àu‹EŒ%ð=€u Ç@©ƒÄøjjè îþÿƒÄ=tƒÄøh8QjèóíþÿƒÄƒÄøh8QjèáíþÿƒÄøjj èÕíþÿƒÄ ƒÄøhfjèÃíþÿÇ…\ÿÿÿ"‹ÞƒÄƒ>„GÇ…dÿÿÿÇ…hÿÿÿƒ=بt+ƒÄôÿ3èÍFƒÄ=tƒÄôÿ3豉…\ÿÿÿƒÄë,ƒÄô…lÿÿÿPj…hÿÿÿP…dÿÿÿPÿ3è9‰…\ÿÿÿƒÄ ƒ=ª„ˆƒÄôÿµdÿÿÿè;qƒÄ…Àtsƒ=Ì©tƒÄôh)èÖîÿÿƒÄƒÄüÿµdÿÿÿƒÄôh0)è2èþÿƒÄPjè/îÿÿƒÄôÿµdÿÿÿè©êþÿƒÄ …Àt!ƒÄüƒÄôÿ5ð­èQèþÿPh>)jèüíÿÿƒÄ ‹…hÿÿÿ…ÀtƒÄôPèÎèþÿƒÄ‹…dÿÿÿ…ÀtƒÄôPèµèþÿƒÄƒÃƒ;…¼þÿÿ‹©…ÒtLƒÄü…`ÿÿÿPÿ5 ©Rè>‰…\ÿÿÿƒÄƒ½`ÿÿÿu$ƒÄüÿ5©ƒÄôhJ)èlçþÿƒÄPjèiíÿÿƒÄƒ=بu#ƒÿƒ=©„¤¡´© ¸©„“ƒÄôÿ5À©ƒ=¼©uƒÄø¡´©‹¸©RPè{ƒÄë¸`)PƒÄôjè$mƒÄPƒÄôh€)èãæþÿƒÄPjèàìÿÿƒÄ èt?…Àt-ƒÄüƒÄôÿ5°©è{zPƒÄôhÀ)è­æþÿƒÄPjèªìÿÿƒÄ ¡ª…Àt ƒÄôPèAÿÿƒÄƒ=ä©tƒ=ªuè?&èÊíÿÿ3Û;ß}ƒÄôÿ4žèMçþÿƒÄC;ß|íè„çÿÿƒ½\ÿÿÿ"t¸ë3À¥8ÿÿÿ[^_ÉÃU‹ìƒìS‹]ƒût¸H,ƒûu ¸@,ë¸N,ƒÄôPè2ïÿÿè!ƒÄøh8QSèŸêþÿ‹]èÉÃU‹ì¸XÉÃU‹ìƒìƒÄôÿuè‹êþÿÉÃU‹ìƒìƒÄüÿu ÿuÿuèêþÿÉÃU‹ìƒìƒÄøÿuÿu èxêþÿÉÃU‹ììœWVS‹u ƒ=T©„5ƒ=Ø‚u{èŠÖÿÿ‹ØÇô­ÇØ‚…Ût\‹û°ü¹ÿÿÿÿò®÷ÑA$ð+à‹üh`,Shg,Wè8çþÿƒÄôSèæþÿƒÄ ƒÄø…xÿÿÿPWèŒçþÿƒÄ…ÀuƒÄôWè`£ô­ƒÄ¡ô­…À„¤ƒ>t ‹Uƒ:…“‹Øë‹[ …ÛtM‹…ÀtóƒÄø‹URPèæþÿƒÄ…Àuß‹…ÀtƒÄøPÿsèäþÿ…ÀtN‹EÇëK‹C‰‹C…Àt=ë6ƒ}t3ƒ>u.‹ô­ë‹[ …Ûtƒ;uô…Ût‹C‰‹Eƒ8u‹C‹U‰¥Xÿÿÿ[^_ÉÃU‹ìƒì WVS‹}‹‹E ‹0…Ût2ƒ{u'ƒÄôÿ3èåþÿƒÄôÿsèöäþÿƒÄ ƒÄôÿsèèäþÿë‰s ‹óƒÄôjèh‹ØÇÇCÇCÇC ‰‹E ‰0eè[^_ÉÃU‹ì‹U€:t ŠBˆB€:uõÉÃU‹ìƒìÚþÿƒÄ…Àu'Çô© Çü©Çø©0铃Äøhø-SèÚþÿƒÄ…Àu#Çô©Çü©Çø©0ëZƒÄøhý-SèÊÙþÿƒÄ…Àu#Çô©Çü©Çø© ë"ƒÄüSƒÄôh .è/ØþÿƒÄPhPªèÚþÿ‹]èÉÃU‹ìƒì WVS‹u ƒÄôjè2\‹Ø‹û3Àü¹ó«ƒÄ9u~‹u‹E‰‰s¡0tPÿ‰SƒÄôPèý[‰CƒÄøhZ.jè×ÛÿÿƒÄ ƒÄøjSèƒÄôÿsèÚ‹Ãeè[^_ÉÃU‹ìƒìVS‹]‹u3É‹CE ‰C‹S…Ò~ ;Â~‰C‹0tBÿ;Ct‰CƒÄøRÿsè²[‰C¹ƒÄ‹Æ+C =Ç…Ét‰s ƒÄøVSè~ƒÄôÿsèWeè[^ÉÃU‹ìƒìS‹]‹U ‹K…É~ ‹C;Á~‰C…ÒuºƒÄøRSè9ƒÄôÿsèƒÄ ƒÄøhæ-jèäÚÿÿƒÄôÿsè±×þÿƒÄ ƒÄôSè¥×þÿ‹]èÉÃU‹ìƒìWVS‹E‹@‰Eì‹U‹R‹M‹ щUðƒÄôRèEj‹Ð‹ú°ü¹ÿÿÿÿò®÷ÑAÿƒÄ= }¸ ‹U‹J+È‹ÁXáƒû3Û‹}‹G…ÀŽ‰ÛEð‰EüÛEüÙÉÜ /ÞñÙ}úf‹UúfÊ f‰UøÙmøÛ]ü‹EüÙmú=d~h\.h<h¥-h°-èzo=cƒÄüPhn.‹MìQèç×þÿƒÄë¡u.‹}쉠y.ˆGƒEìë¡z.‹U쉃‰Uì…Û„;‹M‹A…ÀŽªÛEð‰EüÛEüÞù‰]üÛEüÞÉÙ}úf‹}úfÏ f‰}øÙmøÛ]ü‹UüÙmú;Ó~h.hNh¥-h°-èÎn‹EìÆ[@‰Eì‹È…Ò~"ë ‹}ìÆ=G‰}ì‹ÂJ=ì‹EìÆ>@‰Eì‹Eìë ‹UìÆ B‰Uì‹Â+Á;Ã|î‹MìÆ]A‰Mìé†4]úÿÿÿ‹}‹W‹Â™÷þCþ;Ð}Jë Kû+Ó+Ê‹UìÆ[B‰Uì3À;Ã}ë‹}ìÆ G‰}ì@;Ã|Í‹EìÆ]@‰Eì‹UÿBƒÄüƒÄô‹MðQèhPh•.‹]ìSèWÖþÿ‹Uì‹ú°ü¹ÿÿÿÿò®÷ÑL ÿ‰MìƒÄ ƒ} tb‹E‹P…ÒtXÇEôƒÄüEôP‹M QRèP#ƒÄô‹EôÁàÿ°4tƒìÝ$h¬.‹]ìSèñÕþÿ‹Uì‹ú°ü¹ÿÿÿÿò®÷ÑL ÿ‰MìƒÄ0ë,ºµ.¡µ.‹M쉋B‰A·Bf‰AŠB ˆA ƒÁ ‰Mì‹]‹C…ÀŽa‹S…ÒŽ/ÛE Ü5 /+Eð‰EüÛEü‰UüÞÉÛEüÞùºÅ³¢‘‹ÂÙ}úf‹}úfÏ f‰}øÙmøÛ]ü‹MüÙmú÷éÁû ‹ÑÁú+ÚÝ+ÃÁàÃÁà+Ⱥ‰ˆˆˆ‹Â÷é4Áþ‹ÑÁú+ò‹ÆÁà+ÆÁà‹Ñ+Ð…Ûtƒûc~·Á.‹Mìf‰ Ã.ˆAƒÁ‰Mìëƒû  ‹}ìÆ G‰}ì¡Å.‹M쉠É.ˆAƒÁ‰Mìƒûc~ ƒÄøhË.Që,…Û~ƒÄôRVShÑ.‹]ìSè”ÔþÿƒÄ ëRVhÞ.‹}ìWè|ÔþÿƒÄ‹Uì‹ú°ü¹ÿÿÿÿò®÷ÑL ÿë&ºè.¡è.‹M쉋B‰A‹B‰AŠB ˆA ƒÁ ‰Mì‹]‹K‹Eì+Á‹S;Â~hö.hµh¥-h°-è†k 9Eìs‹}ìÆ G‰}ì‹U‹BB;øré‹MìÆeØ[^_ÉÃU‹ìƒìVS‹]ƒÄôjè§×ÿÿ‹ðƒÄøh(/jè¾ÕÿÿƒÄ ƒÄøSjè°ÕÿÿƒÄôVè×ÿÿeè[^ÉÃU‹ìƒì WVS‹uƒÄôh*/èÏÔþÿ‹ØƒÄ…öt¿//¹ü¨ó¦u Çà‚ƒ=©u4ƒÄôƒÄôhPªè‚ÓþÿPèŒÕþÿƒÄ …Àt…Ût-‹ó¿5/¹ü¨ó¦uƒ=à‚uƒÄôhd-èpòÿÿëèÏi=,~£0teè[^_ÉÃU‹ìƒìè­i=,~£0tƒÄøhfjèbÕþÿÉÃU‹ì‹E‹U ‰P‰Ç€ÉÃU‹ì‹Eƒ8ÿ•À%ÿÉÃU‹ì‹EÇÿÿÿÿÉÃU‹ìƒì‹UƒÄühBPÿ2èÞþÿÉÃU‹ìƒìS‹]ƒ»u-C‰ƒǃƒÄühPÿ3èVÞþÿ…À~‰ƒ‹ƒŠ‹E ˆ¸‹]èÉÃU‹ìƒìVS‹u‹U ‹†…Àu3Àë+‹];Øv‹Ø…ÒtƒÄüSÿ¶Rè»Ðþÿ)žž‹Ãeè[^ÉÃU‹ì‹EÇ€P‰ÉÃU‹ìƒìƒÄôjè¤SÇÇ@Ç@Ç@ ÉÃU‹ìƒìƒÄôÿuè7ÐþÿÉÃU‹ìƒì WVS‹}‹]ƒÄôjèWS‹ð‹E ‰‰^‹U‰VÇF ‹GP‰W‹ÂƒÄ;G ~‰G ƒ=Ì©t5ƒÄü‹EP‹U Rh@/èhÕÿÿƒÄƒ=Ì©tƒÄüÿw ÿwhZ/èIÕÿÿ‹G…Àt‰p ‰wƒ?u‰7eè[^_ÉÃU‹ìƒìVS‹u‹…Ûu3Àëy‹C ‰…ÀuÇF‹‹E ‰‹S‹E‰‹S‹E‰ÿNƒ=Ì©t5ƒÄüÿsÿ3hx/èÏÔÿÿƒÄƒ=Ì©tƒÄüÿv ÿvhZ/è°ÔÿÿƒÄƒÄôSè Ïþÿ¸eè[^ÉÃU‹ìƒì\WVS‹]ÇEÐ"ƒÄøEüPSè„/‰EăÄ…Àu&ƒÄôÿuüè3PSh’/jèÑÓÿÿ¸éÔè/þÿÿ‰ẼÄôjèŽgÿÿ‰EÈjjƒÄô‹EÄÿ0è:RƒÄP‹UÌRèEþÿÿƒÄ ƒÄø‹EÄÿ0‹UÈRè­_ƒÄE܉E´U؉U¸EÔ‰E¼éŸ¡è‚…Àt{ƒÄøÿuàPè;cÿÿƒÄ…ÀthƒÄôƒÄøÿuàÿ5è‚èbÿÿPèÆQ‰EðƒÄ ƒ=Ì©tƒÄüPÿuàh /èŠÓÿÿƒÄƒÄøÿuðÿ5ì‚èg_ƒÄ…À„ƾéÄÇEøÇEô‹بÇبƒÄôEøPÿuäEôPEðPÿuàè‰EЉبƒÄ ƒ}ðt="u‹Eø%=u¾‹Eô…ÀtN…öt6ƒÄô‹UÈR‹UÄRÿuèÿuàPè ƒÄ …Àu3öëƒÄøÿuà‹EÈPèi^ƒÄƒÄôÿuàèÍþÿ‹Eô‰EàƒÄ…ö„T‹Mè‹è¨;Ê|?ƒúÿt:ƒ=ªt;ÊtB;ÈuÆEÃë ƒ=Ì©tƒÄüRQhà/èTÒÿÿƒÄ3ö…ö„ÇEìƒÄüEìPÿuàÿuðè5„ÿÿ‹øƒÄƒ=¨©tƒ}ìtƒÄôWè¼63ÿƒÄ…ÿ„½‹ßƒÄøjÿuàè-‹ðƒÄ…öuh0hTh"0h*0èÒdöCuh€}ÃtöCt\ƒÄô‹UÈR‹EÄPÿuèVSèAƒÄ …Àt@‹Eè@PƒÄôÿuàè®OƒÄPƒÄô‹ÿ0èžOƒÄP‹UÌRè©ûÿÿƒÄø‹ÿ0‹EÈPè]ƒÄ ‹[…Ûu‹ƒÄôVèV3ƒÄôWèõ5ƒÄ ƒ=ªu‹Eð…À„·ƒÄôPè•UƒÄ…À…£ƒ=Ì©t'ƒÄø¸W0ƒ=ªt¸H0Ph€0èñÐÿÿƒÄƒÄüÿuðƒ=ªt ƒÄôh²0ë ƒÄôhÀ0è?ÊþÿƒÄPjè<ÐÿÿƒÄôÿuðè¹ÌþÿƒÄ …Àt!ƒÄüƒÄôÿ5ð­èaÊþÿPhê0jè ÐÿÿƒÄ ƒÄôÿuðèʃăÄôÿuàèØÊþÿƒÄ‹Eä…ÀtƒÄôPèÅÊþÿƒÄ‹Eð…Àt ƒÄôPè°ÊþÿƒÄ3ö‰uðÆEÃèR"…ÀuNƒ}ÐtHEèPEäPEàP‹UÌRèëúÿÿƒÄ…À…,üÿÿë&ƒÄôÿuÔèeÊþÿƒÄ‹EØ…ÀtƒÄôPèRÊþÿƒÄ‹E´P‹U¸R‹E¼P‹UÌRè£úÿÿƒÄ…ÀuÀƒÄô‹EÌPèÜùÿÿƒÄƒ}ÄtƒÄô‹UÄRè«1ƒÄƒÄô‹EÈPè¼[è¯!…Àt¸6ëƒ}Ðt ¸"ë¸e˜[^_ÉÃU‹ìƒìWVS‹}‹u‹‹‰Eøƒ=Ì©tƒÄøPh1è;ÏÿÿƒÄƒÄø‹UøR‹EPè[ƒÄ…Àtƒ=Ì©„@ƒÄôh#1é‹C…Àt-=u ƒ=4©uIƒ=Ì©„ ƒÄôh@1éãƒ=à¨t#öGuƒ=Ì©„àƒÄôh€1é·ƒÄôSè[iÿÿƒÄ…Àuƒ=Ì©„³ƒÄôh®1銃=ä¨tk‹F9CucƒÄøÿvÿsè1ÉþÿƒÄ…ÀuN‹F 9C uFƒ=ªtöGu7ƒÄøÿs ÿv èYSƒÄ…Àu"ƒ=Ì©„EƒÄüÿv ÿs hà1éƒ= ©u ƒ=©t6ƒÄøjÿs èµSƒÄ…Àu"ƒ=Ì©„ýƒÄüÿs ‹UøRh 2éÍ‹C$€8t|ƒÄô‹uøVè¬T‹ÐƒÄ…Òt7¿C2¹‹ðü¨ó¦t‹ò¿H2¹ü¨ó¦u¡è¨=ÿÿÿÿt59E|0ƒÄôÿs$èÉQƒÄ…Àuƒ=Ì©„uƒÄüÿs$‹EøPh`2ëH‹U ‹B9CuMƒ=ܨuDƒÄøÿsÿrèîÇþÿƒÄ…Àt/ƒ=Ì©„.ƒÄü‹u ÿvÿsh 2èëÌÿÿƒÄé÷ƒ=¨©„ǃ{…½ƒÄøÿs ÿs裋ðƒÄ…öu\ƒÄøEüP‹EøPèƒÄ…ÀtƒÄôÿuüè4 ‹ðƒÄôÿuüèëÆþÿƒÄ ëƒÄøjhÜ2èõ ‹ðƒÄƒÄüVÿs ÿsèuƒÄƒÄøÿsVèæƒÄ…Àu7ƒ=Ì©tƒÄø‹UøRhà2è)ÌÿÿƒÄƒÄø‹uøV‹EPèÄWƒÄë#ƒ=Ì©tƒÄôh3èöËÿÿ¸ëƒ=Ì©tƒÄôh&3èÖËÿÿ3ÀeØ[^_ÉÃU‹ìƒì WVSƒÄøjÿu èÂ&‰EüƒÄ…Àuh?3hqh"0h*0è^ƒÄøj‹EPèŽ&‹ðƒÄ…öuhS3hth"0h*0è\^ƒÄôj èöH‹Ø‹û3Àü¹ó«‰3ƒÄôÿuÿuÿu‹EüPSèÄûÿÿ‹øƒÄ0ƒÄô‹MüQè-ƒÄôVè-ƒÄ ƒÄôSènÅþÿƒÄ…ÿuƒ=Ì©tƒÄø‹EPh€3èåÊÿÿ‹Çeè[^_ÉÃU‹ìWVS‹]‹M 3öëCAFŠ„Òt Š„Àt:Ðtí…ötŠ„Àu€9u¸ë?€9t3Àë3‹ñ„Àt‹ó€>/tN€>/u€~tÑ¿£3¹ ü¨ó¦”À%ÿ[^_ÉÃU‹ìƒìVS‹]‹u ƒÄøÿuVè¦ÃþÿƒÄ…Àu$ƒÄøSÿ5è‚è¤[ÿÿƒÄôSè‡ÄþÿƒÄ ƒÄôVè{Äþÿ3Àeè[^ÉÃU‹ìƒìƒÄüÿuh˜sÿ5è‚è \ÿÿÉÃU‹ìƒìWVS‹}ƒ=ð‚uƒÄôjè%]ÿÿ£ð‚ƒÄƒ=è‚uƒÄôjè ]ÿÿ£è‚ƒÄuüV]øS‹E Pÿ5ð‚è^XÿÿƒÄ…ÀtzƒÄøÿuüWèãÂþÿƒÄ…À„öƒÄøÿuüWèŒþÿÿƒÄ…ÀtƒÄøWÿ5è‚è¾XÿÿƒÄ…ÀteƒÄø‹E Pÿ5ð‚è±ZÿÿƒÄôÿuøè’ÃþÿƒÄ ƒÄôÿuüè„ÃþÿƒÄô‹E PèÿÿÿƒÄ ƒÄüƒÄôWèGPƒÄô‹E PèGƒÄPÿ5ð‚èÅYÿÿƒÄ SVWÿ5è‚è¤WÿÿƒÄ…Àt+ƒÄøWÿ5è‚è:ZÿÿƒÄôÿuüèÃþÿƒÄ ƒÄôÿuøè ÃþÿƒÄƒÄüƒÄô‹E Pè¯FPƒÄôWè¥FƒÄPÿ5è‚èZYÿÿeØ[^_ÉÃU‹ìƒìVS‹uƒ=ð‚uƒÄôjè®[ÿÿ£ð‚ƒÄƒ=è‚uƒÄôjè‘[ÿÿ£è‚ƒÄƒÄøÿu ÿ5è‚èlVÿÿ‹ØƒÄ…Ûuh¯3h=h"0h*0èúZƒÄøVÿ5è‚èYWÿÿƒÄ…Àu%ƒÄüƒÄôSèòEPƒÄôVèèEƒÄPÿ5è‚èXÿÿeè[^ÉÃU‹ìƒìS‹]ƒ=ð‚uƒÄôjèóZÿÿ£ð‚ƒÄƒ=è‚uƒÄôjèÕZÿÿ£è‚ƒÄEüPEøPSÿ5ð‚è-VÿÿƒÄ…Àt1ƒÄøSÿ5ð‚èÃXÿÿƒÄôÿuøè¤ÁþÿƒÄ ƒÄôÿuüè–ÁþÿƒÄôSèýÿÿ‹]èÉÃU‹ìƒìS‹] ¡ì‚…ÀuƒÄôjè_Zÿÿ£ì‚ƒÄëƒÄøSPè^VÿÿƒÄ…Àu#ƒÄøSÿ5ì‚èˆRƒÄøSÿ5ô‚è­Q£ô‚‹]èÉÃU‹ìƒì,WVS3öè@W‰EôƒÄôÿ5ô‚è³Q£ô‚‰EøƒÄ…À„V‹Eø‹‰EìƒÄøPÿ5ð‚èÁTÿÿ‹ØƒÄ…Ûu(ƒ=Ì©„ƒÄø‹EìPhÀ3èJÆÿÿƒÄéÿƒ=Ì©tƒÄüS‹EìPhá3è%ÆÿÿƒÄƒÄüjS‹EìPèxÿÿ‰Eð‹ØƒÄF‰uè…Û„˜‹;öCt ÇCë{ƒÄøÿ7ÿ5è‚è(Tÿÿ‹ðƒÄ…öt/ÇCƒÄôVèÛC‰CƒÄƒ=Ì©t@ƒÄüVÿ7h4ë+öCuÇCÇCƒ=Ì©tƒÄøÿ7h@4èsÅÿÿƒÄ‹[…Û…iÿÿÿƒÄø‹EðP‹EìPèY9‹uèƒÄô‹EðPèò)ƒÄ ‹Eø‹@‰Eø…À…ªþÿÿƒÄô‹EôPèV‹ØƒÄô‹EôPèÌU‰]üÛEüÜ5¨4ƒÄ ƒÄôƒìÝ$VƒÄôh€4èj¾þÿƒÄPjègÄÿÿeÈ[^_ÉÃU‹ìƒì¡ð‚…Àt$ƒÄôPè8QƒÄôÿ5ð‚èâRÿÿÇð‚ƒÄ ¡è‚…Àt$ƒÄôPè QƒÄôÿ5è‚èµRÿÿÇè‚ƒÄ ¡ì‚…Àt ƒÄôPèŽPƒÄƒÄôÿ5ô‚èÑOÇô‚ÉÃU‹ìƒìVS‹U‹E ‹]‹u=u €:*uÇë2=u%ƒÄüjhÀ4Rèµ¾þÿ…ÀuÇÇëÇÇeè[^ÉÃU‹ìƒìS‹]‹E ‹U;Âs€8/u@ƒÄøRPèdB‰Eô‹E‰Eø‹E‰Eü‹P‰‹Â‹SƒÄ;Â~+…Òu ÇCëÒ‰SƒÄø‹C@ÁàPÿsèJA‰C‹@ÁàC‹Uô‰Pô‹Uø‰Pø‹Uü‰Pü‹]èÉÃU‹ìƒìWVSÇEø‹E‹9Uø}‹@‹Êƒ8tÿEø IuðƒÄô‹UøRÁàPè®@‹ø3ɉMüƒÄ‹E;}93Û3ö‹E‹Pƒ|t‹‰7‹D‰D7‹D‰D7ƒÆ ÿEüƒÃ A‹U; |Ì‹Mø9MüthÅ4h®hÎ4hÔ4èŸUƒÄô‹Eÿpèö¼þÿ‹U‰z‹Mø‰ ‰JeØ[^_ÉÃU‹ìƒì¹þÿƒÄƒÆ C;|ç‹G…Àt ƒÄôPè#¹þÿƒÄƒÄôWè¹þÿeè[^_ÉÃU‹ìƒìWVS‹E‰Eü‹} ‹MüŠ ˆMûŠˆ]ú„Éu ¸é €}ú„þ€}û%uu‹Eü¾p‹Ö¶Ò»à8öDSt]¾@‹È%ÿöDCtK‹]üŠCÐ< wVÐë ¶‚à;PÉÁâ‹]üŠCÐ< wDÐë¶É¶à;DÉP‹EèPh7jè µÿÿƒÄ ƒÄô‹UèRèâ¯þÿ¸éTƒ}u¡à©‰EÇEìÇEðÇEô3Ûƒ=p©t.ƒÄôÿwèw(ƒÄ…ÀtƒÄøÿ5„©ÿwèï(ƒÄ…À•À¶Ø…Û„0ƒÄôÿwèA(‹ØƒÄ…ÛuLƒÄøƒÄôh7è\®þÿPjèl²ÿÿƒÄ ƒÄôWèԃă}ätƒÄô‹UäRèß@ƒÄƒÄô‹EèP鎃ÄøUøRSè«‹ðƒÄ…öu*ƒÄôÿuøè+PSƒÄôh@7èð­þÿƒÄPjèí³ÿÿë.ƒ~tVƒÄüSƒÄôh€7èÉ­þÿƒÄPjèƳÿÿƒÄôVèAƒÄ ƒ}ätƒÄô‹EäPèL@ƒÄƒÄô‹UèRè®þÿ¸4éóƒÄøV‹EP‹UREôPEðPWè‡ÿÿ‰EìƒÄ ƒÄôVèçƒÄé‹G…Àu)ƒÄøj‹EP‹UREôPEðPWèÒ†ÿÿ‰EìƒÄ é’=…„‹5بƒ}ät ÇبƒÄø‹EPWèò ÿÿ‰Eì‰5بƒÄƒ}ätO‹Eô…ÀtHƒuBƒÄôPèV:‹ØƒÄ…Ût0ƒÄøh¦7Sè®þÿƒÄ…ÀtƒÄøh«7Sèþ­þÿƒÄ…Àu‹U€ ƒ}ì…ƒ}ðuh¯7h¹hŸ6h¦6èðE‹Eô…Àt ƒÄôPèH­þÿƒÄƒÄøÿuð‹EèPèB#‹ðƒÄôÿuðè)­þÿ‰uðƒÄ ƒÄøUøRVè¾ ‹ðƒÄ…öu]ƒÄôÿuøè>Pÿuðh7jè ²ÿÿƒÄ ƒÄôW肃ă}ätƒÄô‹EäPè>ƒÄƒÄô‹UèRè¬þÿƒÄôÿuðè·¬þÿé+ƒÄôÿuð襬þÿƒÄôÿ6èO0‰EðƒÄ ƒ}äuƒÄôjèyEÿÿ‰EäƒÄøÿ7Pè¿=ƒÄ ÿEàƒ}à~SƒÄüjƒÄôhÀ7èi«þÿƒÄPjèf±ÿÿƒÄôVèáƒÄ ƒÄôWèՃă}ätƒÄô‹UäRèà=ƒÄƒÄô‹EèPëgƒÄøÿ6‹UäRè–=ƒÄ…ÀtoƒÄüÿuðƒÄôhà7è«þÿƒÄPjèý°ÿÿƒÄôVèxƒÄ ƒÄôWèlƒÄƒ}ätƒÄô‹EäPèw=ƒÄƒÄô‹UèR謫þÿƒÄôÿuðè¡«þÿ¸%éƒÄøÿ6‹EäPèÎ<ƒÄô‹UèRèz«þÿ‹Eð‰EèƒÄ ƒÄôWè‹þƒÄé˜ûÿÿ‹Eô…ÀtE‹Uöt=ƒÄøPÿ7èòæÿÿƒÄƒ}ätƒÄøÿ7‹EäPè—úÿÿƒÄ‹UötƒÄøÿuôÿ7è‹éÿÿƒÄƒ} t ‹Eô‹U ‰ë‹Eô…Àt ƒÄôPèðªþÿƒÄƒÄôWèƒÄƒ}ät2ƒÄô‹EäPèŠ<ƒÄƒ}t ‹Eè‹U‰ë.ƒÄô‹UèR謪þÿëƒ}t ‹EǃÄô‹UèRèªþÿÿª‹EìeÈ[^_ÉÃU‹ìƒìWVS‹Eƒ} tƒÄüjjPèýaÿÿë ƒÄôP觃ċø¾"‹EÇ‹ßé ‹ƒ=بt‹ÂƒztƒÄôÿ0èÛÿÿ‹ðƒÄëƒÄôEüPjEøPEôPÿ2è€ùÿÿ‹ðƒÄ ‹Eô…À„ƒ=ª„€ƒÄôPè²1ƒÄ…Àtpƒ=Ì©tƒÄôh 8èM¯ÿÿƒÄƒÄüÿuôƒÄôh^8è­¨þÿƒÄPj誮ÿÿƒÄôÿuôè'«þÿƒÄ …Àt!ƒÄüƒÄôÿ5ð­èϨþÿPhl8jèz®ÿÿƒÄ €eüý‹Eø…Àt ƒÄôPèK©þÿƒÄ‹Eô…Àt ƒÄôPè8©þÿƒÄ‹[‹Uÿ…Ût&ÇEôÇEøöCuàèÃ…À„Óþÿÿ¾6ƒÄôWè=‹ÆeØ[^_ÉÃU‹ìƒì‹E ƒÄø9Eu ƒÄôhx8ë ƒÄôh…8èÓ§þÿƒÄPjèà«ÿÿÉÃU‹ìƒ=¼©uX¡´©‹¸©‹M£´©‰¸© ´©ƒ¸©‹ ¸©;Ñw u&;´©vǼ©Ç´©ÿÿÿÿǸ©ÿÿÿÿÉÃU‹ìS‹°©…Òt ƒ=¼©t3Àë!3ۋ™‹ ¸©;Êw u 9´©v»‹Ã[ÉÃU‹ìƒìS‹Mƒ=TttÇTt鋤©…Òtƒù~;Ê ƒÄôAÿë'ƒÄôRèÓ«þÿëf¡ ©…Àt\ƒ=œ©tƒù~ ƒÄôPè°«þÿëCƒÄôÀ@PèÄ?‹ØƒÄƒ=Ì©tS¡ ©‹Ó+ÐRPh 8è­ÿÿƒÄ…Ût ƒÄôSèk«þÿ‹]èÉÃU‹ìƒìWVS‹}‹ß€?„›ŠˆEö<%tŠEöˆëŠCˆEÿ„ÀtïŠCˆE÷„Àtå¾C‰Eø‹Ð¶Ò¾à8öDVt;C‹È%ÿöDFt»ŠEÿÐ< w ‹UøƒÂÐë ¶‚à;PÉÁâŠE÷Ð< wDÐë¶É¶à;DɈƒÃCG€;…fÿÿÿÆ[^_ÉÃU‹ìƒìWVS‹u3Ò‹Þ€;t¹=¶ötƒÂC€;uî…Òu ‹Æé‘+ÞÚ‰]üƒÄô‹Ã@Pè…)‹ø‹Þ‹×ƒÄ€;tG¶ö€=t3ŠˆEûCÆ%B‹òBÀèH7< wH0ˆ‹òBŠEû$H7< wH0ˆ뼊ˆCBë´Æ+×;Uüth>hÐh>h>èi>‹ÇeØ[^_ÉÃU‹ìƒìS‹]ƒÄôSèÿÿÿƒÄ;Ãu ƒÄôPèU)‹]èÉÃU‹ìƒìWVS3ÿ‰}ô‹]€;„À;%…ƒ¾s‹Ö¶ÒöUá8„‚¾C‹È%ÿöEá8tmŠCÐ< wVÐë ¶‚à;PÉÁâŠCÐ< wDÐë¶É¶à;DÉ%ÿŠ€=¨u¨tºë3Ò붊€=º¨t ¨uºƒútrëGëÿEôC€;…?ÿÿÿ…ÿuƒ}ôu ‹Eé°+]+}ô<{‰}øƒÄô‹Ç@PèÐ'‰Eü‹]‹ðƒÄ€;„\€;%…ƒ¾{‹×¶ÒöUá8„‚¾C‹È%ÿöEá8tmŠCÐ< wWÐë ¶‚à;PÉÁâŠCÐ< wDÐë¶É¶à;DÉ%ÿŠ€=¨u¨tºë3Ò붊€=º¨t ¨uºƒútrJƒú„™é;ÿÿÿŠˆEóCÆ%F‹ÎFÀèP7< wP0ˆ‹ÎFŠEó$P7< wP0ˆéÿÿÿ‹ÎFŠCÐ< w ¾CPÐë¶C¶€à;PÉÁâŠCÐ< w ¾CDÐë¶C¶€à;DɈƒÃéªþÿÿŠˆCFéœþÿÿÆ+uü;uøth>h›h>h>è˜;‹EüeØ[^_ÉÃU‹ìƒì WVSÇEüƒ=XttQ¾`t3ÛƒÄü‹“Xt‹ú°ü¹ÿÿÿÿò®÷ÑAÿPR‹EPèï¢þÿƒÄ…Àu ƒ>t‹EüëƒÆ ƒÃ ÿEüƒ»Xtu¶¸eè[^_ÉÃU‹ìVS‹]‹Ë¶¸à8‹ðöVŒuŠëA¶öFŒuöŠ<-tð<+tì€9:t3ÀëA€9/u €y/uƒÁ+Ë‹Á[^ÉÃU‹ìS‹M¶¸à8‹ØöSŒt A¶öCŒuöŠ<-tð<+tì<:”À%ÿ[ÉÃU‹ì‹E@‹…\tÉÃU‹ì‹E@Ç…`tÉÃU‹ìƒìS‹]ƒÄøh:>SèÄ¥þÿ…Àt€8@t3Àë+Ã@‹]èÉÃU‹ìƒì WVS‹u …ötƒÄüVj:‹EPè=¢þÿ‹øƒÄ;}u 3À饅ÿt@‹EH‹×+ЋÞ+ÚƒÄôCPèx$‹Ð‹E‰GƒÄüSPRè7¡þÿ‹U‹ÆN+óƒÄ ë ‹EǃÄôFPè;$‹U‰ƒÄüV‹URPèü þÿ‹U‹ÆƒÄ ‹…Àt ƒÄôPè}ùÿÿƒÄ‹U‹…Àt ƒÄôPèhùÿÿ¸eè[^_ÉÃU‹ìƒì WVS‹uƒÄôVèsþÿÿƒÄ…Àu‹ÞŠëCŠ„Àt<:t>Wè,¡þÿ+ÞÆD/‹Çë.ƒÄô‹þ°ü¹ÿÿÿÿò®÷ÑAPè"#‹ØƒÄüVhG>Sèõ þÿ‹Ãeè[^_ÉÃU‹ìƒìWS‹]ƒÄøÿu SèÑ£þÿ…Àu‹û°ü¹ÿÿÿÿò®÷ÑD ÿeè[_ÉÃU‹ìVS‹U3É€:t&¾à8»à:¶€üÿÿ‰EôƒÄ=u…ö„ ÇéƒÄô‹URèhùÿÿ‰EÀ‹MôI‹<…Xt°ü¹ÿÿÿÿò®÷Ñ‹UÀL ÿ‰MðƒÄôQèýÿÿEð‰EìÇEØÇEÜÇEÐÇEÔÇEÈÇEÌƒÄ ƒÄøhš>PèÌþÿÿ‰Eè‹ØƒÄ9]ìu…ö„oÇédƒÄô‹MôQè|üÿÿ‰EăÄ‹}è€?:uj‹ßC‹ûƒÄøh >Wè{þÿÿ‹ØƒÄ;ûu…ö„ ÇéÇEÄ‹×;Ós+¾ ‹Á%ÿöEà8tÈ‹}Ä¿DAЉEÄB;ÓrÚ€;/uC‰]äƒÄøh¥>Sè þÿÿ‰Eà‹ØƒÄë ‰]à‰]ä€;;uC‰]܃Äøh©>Sèãýÿÿ‰E؋؃Ä€;?uC‰]ÔƒÄøh¬>SèÄýÿÿ‰EЋ؃Ä€;#uC‰]Ì‹û°ü¹ÿÿÿÿò®÷ÑL ÿ‰MÈ‹Ù€;th®>hh>h>èÞ5‹Uì9Uðt4EüPEøP‹Â+EðHP‹MðQè˜ûÿÿƒÄ…Àu…öt Ç3Àé<ƒÄôj0è: ‹Ø‹û3Àü¹ ó«‹}ô‰{ƒÄø‹EèP‹UìRè!‰C‹MĉK ‹Eø‰C(‹Eü‰C,ƒÄ ƒÄø‹}àW‹EäPèî ‰CƒÄôPè^‹øƒÄ ƒÄüC$PC PÿsèƒÄôÿsèïüÿÿ‹ðƒÄ ƒ}ÜtƒÄø‹UØR‹MÜQè¤ ‰CƒÄƒ}ÔtƒÄø‹EÐP‹UÔRèˆ ‰CƒÄƒ}ÌtƒÄø‹MÈQ‹EÌPèl ‰CƒÄ…ÿuƒ{u …öu‹Uà9Uäu(ƒÄøjSè]‰ƒÄ‹M9MÀt-ƒÄô‹}ÀWèð›þÿë‹E9EÀuƒÄô‹UÀR茉ë‹MÀ‰ ‹Ãe¨[^_ÉÃU‹ìƒì‹E=vhÀ>hKh>h>è34‹…|tÉÃU‹ìƒì WVS‹U‹u ‹ú°ü¹ÿÿÿÿò®÷ÑA$ð+à‹üƒÄøRW茜þÿƒÄƒÄôWèüóÿÿƒÄøj/Wèžþÿ‹ØƒÄ …ÛuƒÄôhú>è㉃ÄôWëƒÄøSWèV‰ƒÄôCPèÀ‹U‰eè[^_ÉÃU‹ìWS‹U3Û‹z…ÿt°ü¹ÿÿÿÿò®‹Ù÷Ó‹z…ÿt°ü¹ÿÿÿÿò®÷ÑÙ‹z…ÿt°ü¹ÿÿÿÿò®÷ÑÙ‹Ã[_ÉÃU‹ìƒì WVS‹u ‹E‹@‰Eü…Àt+‹ø°ü¹ÿÿÿÿò®÷ÑYÿÆ/FƒÄüS‹EüPV耚þÿóƒÄ‹E‹@‰Eü…Àt+‹ø°ü¹ÿÿÿÿò®÷ÑYÿÆ;FƒÄüS‹EüPVèHšþÿóƒÄ‹E‹P…Òt"‹ú°ü¹ÿÿÿÿò®÷ÑAÿÆ?FƒÄüPRVèšþÿeè[^_ÉÃU‹ìƒì WVS‹]ƒÄôSèëþÿÿ‹øƒÄôGPè‹ðƒÄ ƒÄøVSèÿÿÿÆ7‹Æeè[^_ÉÃU‹ìƒì WVSƒÄô‹Eÿp襙þÿ‹U‹z ƒÄ€?uƒÄôÿr$è@‹øëc°ü¹ÿÿÿÿò®÷ÑYÿ‹U‹z$ü¹ÿÿÿÿò®÷ÑqÿƒÄôDPè•‹øƒÄüS‹Eÿp WèW™þÿÆ;/D;ƒÄ ƒÄüV‹Uÿr$Pè<™þÿóÆD7ƒÄƒÄôWè}óÿÿ‹ØƒÄ;ßtƒÄôWè™þÿ‹ûƒÄ‹E‰xƒÄôÿ0èð˜þÿƒÄøj‹URè6‹U‰eè[^_ÉÃU‹ìƒìVS‹]‹u ƒÄôÿs 軘þÿƒÄôVèf‰C ƒÄ ƒÄôSèçþÿÿeè[^ÉÃU‹ìƒìVS‹]‹u ƒÄôÿs$胘þÿƒÄôVè.‰C$ƒÄ ƒÄôSè¯þÿÿeè[^ÉÃU‹ìƒìS‹]ƒÄôÿsèO˜þÿƒÄôÿsèD˜þÿƒÄ ƒÄôÿ3è7˜þÿƒÄ‹C…Àt ƒÄôPè$˜þÿƒÄ‹C…Àt ƒÄôPè˜þÿƒÄ‹C…Àt ƒÄôPèü—þÿƒÄ‹C(…Àt ƒÄôPèè—þÿƒÄ‹C,…Àt ƒÄôPèÔ—þÿƒÄƒÄôÿs èÅ—þÿƒÄôÿs$躗þÿƒÄ ƒÄôSè®—þÿ‹]èÉÃU‹ìƒì,WVSƒÄô‹EPè%‰EøƒÄ…Àu)ƒÄôÿ5ð­èÛ–þÿP‹URhû>jè‚œÿÿ3À鞃=Ì©tƒÄü‹Møÿq‹EPh?èØœÿÿƒÄÇEðÇEô‹Uø‹2‰uì‹JMì;uìƒC‹þƒÄü‹Eì+ÇPj WèÔ—þÿ‹ÐƒÄ…Òu‹UìëB‹ò;þs¶¹à8öA@tG;ús ¶öA@uò;×vª¶Bÿ¹à8öA@tJ;×v“¶BÿöA@uñ;×v…ƒÄøRWè׋øƒÄ¡ˆ©…ÀtƒÄøWPè ‹ØƒÄôWèx–þÿ‹ûƒÄ ƒÄøEüPWè÷ÿÿ‹ØƒÄ…Ûu5ƒÄôƒÄôÿuüè‹úÿÿPW‹EPh?jèU›ÿÿƒÄ0ƒÄôWè1–þÿƒÄé ÿÿÿƒÄôWè–þÿƒÄôj èQ‰Eè‹ø3Ò‹Âü¹ó«‹Eè‰P‰ƒÄ ƒ}ôu‰Eôë ‹Mè‹Uð‰J‹Eè‰Eðé¸þÿÿƒÄô‹UøRèä$‹EôeÈ[^_ÉÃU‹ìƒìVS‹]…Ût;‹s‹…Àt ƒÄôPè6ýÿÿƒÄ‹C…Àt ƒÄôP臕þÿƒÄƒÄôSè{•þÿ‹ÞƒÄ…ÛuÆeè[^ÉÃU‹ììœWVSƒÄôÿ5Ø©è)‹Ð‹}°ü¹ÿÿÿÿò®÷ÑD$ðƒÄ+à‰¥tÿÿÿ+à‹üƒÄø…xÿÿÿP‹EP襖þÿƒÄ…Àu‹EŒ%ð=€uo‹5Ø©ƒþ~F^ÿS‹EPh2?‹…tÿÿÿPèû•þÿV‹EPh2?Wèë•þÿƒÄ ƒÄøW‹…tÿÿÿPèè˜þÿƒÄ‹óƒþºj‹EPh2?W轕þÿƒÄøW‹EPèÀ˜þÿ¥Xÿÿÿ[^_ÉÃU‹ììWS‹U‹ú°ü¹ÿÿÿÿò®÷ÑD ÿ€8/t;ÂtH€8/t;Âuö;Âu€8/t 3À馃ÄøPRèn‹øƒÄø…xÿÿÿPWè°•þÿƒÄ …ÀuE‹EŒ%ð=@uƒÄôWè”þÿ3Àëeƒ=Ì©tƒÄøWh@?è}™ÿÿƒÄƒÄôWèw•þÿƒÄƒÄôW賋؃ąÛtƒÄôÿ5ð­è“þÿPWhj?j辘ÿÿƒÄ ƒÄôWèš“þÿ‹Ã¥hÿÿÿ[_ÉÃU‹ì‹U3É€:t ŠB/uFƒ=ø¨„ÃÄô‹Mÿq èq&‹Ø‹©‹ú°ü¹ÿÿÿÿò®÷щMì‹}‹‰}ðü¹ÿÿÿÿò®÷Ñ‹}ìD9ÿD$ðƒÄ+à‹Ü€:.u€zt‹EðPRhq?Sè‚“þÿë ƒÄø‹UðRS胓þÿƒÄƒÄô‹MÿqèZðÿÿƒÄ‹}9G tH‹û°ü¹ÿÿÿÿò®÷ÑAÿÆ:ƒÄø‹Uÿr DPè&ƒÄë¡©€8.u€xt‹Øë»ú>€;tK‹û°ü¹ÿÿÿÿò®‹Ñ÷Ò‹þü¹ÿÿÿÿò®÷ÑD$ð+à‹üƒÄôV¸w?€>/u¸ú>PShy?WèÄ’þÿ‹÷ƒÄ ‰uüƒÄôVè÷ëÿÿ‹ð‹þ°ü¹ÿÿÿÿò®÷ÑAÿƒÄ…Àt €|ÿ/uÆDÿ‹U‹B$ÇEø€?€8t‰EøƒÄô‹þ°ü¹ÿÿÿÿò®‹Ñ÷Ò‹}øü¹ÿÿÿÿò®÷ÑT ÿƒ}ôt‹}ôü¹ÿÿÿÿò®‹Â+ÁëBPèO‹ØƒÄô‹}øW¸ú>€>t¸w?PVhy?Sè’þÿƒÄ0ƒ}ôtƒÄøh‹?Sè7“þÿƒÄø‹EôPSè*“þÿƒÄ ;uüt ƒÄôVè¹þÿ‹ÃeØ[^_ÉÃU‹ìì WVS•ÿÿÿ‹]Šˆ…ÿþÿÿ‹ú„Àtb¶ö€=t8CÆ%B‹òBŠ…ÿþÿÿÀèH7< wH0ˆ‹òBŠ…ÿþÿÿ$H7< wH0ˆëŠˆCBŠˆ…ÿþÿÿ„Àt ‹Â+Ç=ÿvŸƒ} tN‹Â+Ç=ÿwVÆ?B‹] Š „Ét6‹Â+Ç=ÿw>‹÷€ù/uÆ%BÆ2BÆFBCëˆ CBŠ „Ét ‹Â+Æ=ÿv׋Â+Ç=ÿwÆëÆEÿƒÄôWèg¥èþÿÿ[^_ÉÃU‹ìƒìWS‹U3ÿƒ=ì¨tƒÄôRèüÿÿ‹Ø¿ë+‹B$¹€?€8t‹È‹B3Ò…Àt€8t‹ÐƒÄøRQè«þÿÿ‹ØƒÄ…ÿu\‹=©€?.u€tKƒÄô°ü¹ÿÿÿÿò®‹Ñ÷Ò‹ûü¹ÿÿÿÿò®÷ÑPèS‹øSÿ5©hq?Wè#þÿƒÄ ƒÄôSè÷Žþÿ‹ßƒÄƒ=ü¨uƒ=H©uƒ=Щu ƒ=ì¨t&ƒÄôS襃ąÀtƒÄôS豃ąÀt‹ÃëƒÄôSè[‹øƒÄôS蔎þÿ‹Çeè[_ÉÃU‹ìƒìS‹]ƒÄøh?Sè¨îÿÿ+Ë]èÉÃU‹ì‹U‹E ŠM;Âv 8tH;Âw÷3ÀÉÃU‹ìƒìWVSÇEü‹E€8/u@‰E‹U‰Uø‹ú°ü¹ÿÿÿÿò®÷Ñ4 éà€ú.uw‹MøŠQ€ú/t„Òuh‹]ø‹};ßvK;ßv€{ÿ/tK;]v€{ÿ/uôÇEü€ú/u,ƒÄüFý+EøP‹EøPSèoŽþÿCý)Eø+uø‰]øƒÄënÆéµéT‹E €8/…˜3ÿ‹U3öƒÄü‹Ã+ÂPj/Rèý‹þÿƒÄ…Àt…öu€x/u P¾ëÕ…Àu …öt …Àu‹ûë…öu‹}ë …Àt‹ø‹ß+]ƒÄô‹U4FPè‹øƒÄ…ÛtƒÄüS‹EPWèЊþÿƒÄƒ}„Wÿÿÿé>ÿÿÿÇEüƒÄüj/S‹EPè.üÿÿƒÄ…Àt ;Et€xÿ/u CÇEüë@‹Ø+]ƒÄô‹U4FPèœ ‹øƒÄ…ÛtƒÄüS‹EPWèYŠþÿƒÄƒ}ütÆDÿ/ƒ}„Õþÿÿ;ƒÄü‹UR‹U RPè-Šþÿé¼þÿÿƒÄø‹E EP‹E Pè=‹ø‹Çeè[^_ÉÃU‹ìƒì WVS‹]‹u ƒÄôVè¸çÿÿƒÄ…À”À%ÿP‹þ°ü¹ÿÿÿÿò®÷ÑAÿPVSèáüÿÿeè[^_ÉÃU‹ìƒì,WVSÇEôÇEð‹U‹B@Áà‹ˆ\t‰Mì‹°XtƒÄôRèuîÿÿ‰EèƒÄ…öuh‘?hh>h>èæ!‹U‹B(…Àt9ƒÄôPè¡âÿÿ‰EôƒÄ‹M‹A,…Àt ƒ} t ÇEð¤?ëƒÄôPèwâÿÿ‰EðƒÄ‹þ°ü¹ÿÿÿÿò®‹Ù÷Ó‹E‹x°ü¹ÿÿÿÿò®÷ÑD þ‹UèK‰Mü‹U‹B ;EìtƒÄôPèw\‰]üƒÄƒ}ôt(‹}ô°ü¹ÿÿÿÿò®÷ÑMüƒ}ðt‹}ðü¹ÿÿÿÿò®÷ÑMüƒÄô‹UüRè» ‰EøƒÄ‹þ°ü¹ÿÿÿÿò®÷ÑYÿƒÄüSV‹UøRèjˆþÿ‹uøóƒÄƒ}ôtX‹}ô°ü¹ÿÿÿÿò®÷ÑYÿƒÄüS‹UôRVè<ˆþÿóƒÄƒ}ðt)Æ:F‹}ð°ü¹ÿÿÿÿò®÷ÑYÿƒÄüS‹UðRVè ˆþÿóƒÄÆ@F‹M‹I‰Mä‹ù°ü¹ÿÿÿÿò®÷ÑYÿƒÄüS‹UäRVè܇þÿóƒÄ‹Eì‹M9A tÆ:FƒÄøÿq Vè°‹ðƒÄƒÄøV‹URèëìÿÿuèÆFƒÄ+uø;uüth¯?h9h>h>è ƒ}ôt‹Eô‹M;A(t ƒÄôPèR‡þÿƒÄƒ}ðtƒ} u‹Mð‹U;J,t ƒÄôQè/‡þÿ‹EøeÈ[^_ÉÃU‹ìƒìS‹E3Û=ts3‹x©…Ûu-ƒÄôhÂ?ë‹|©…ÛuƒÄôhÍ?èQ‰þÿƒÄ‹Ø…Ût€;u3Àë4ƒÄôSèæÿÿƒÄ…ÀtƒÄühPh@£艈þÿÆ?§»@£‹Ã‹]èÉÃU‹ìƒì‹E …ÀtƒÄøÿuPèC'ÿÿ…À”À%ÿë¸ÉÃU‹ìƒì,WVS‹] ÇEôÇEðƒÄü‹EPƒÄôh×?èF…þÿƒÄPjèC‹ÿÿ3ҋÃÄ…ÛtƒxtB‹@…Àuò…ÒuƒÄøƒÄôhé?è…þÿPjè‰ÿÿégƒÄô‹URèp‰EüƒÄ…Àu2ƒÄôÿ5ð­è,…þÿP‹MQƒÄôh@èÊ„þÿƒÄPjèÇŠÿÿé ƒÄø‹EPj袃ă=Ô©t…ÀtƒÄøP‹URèƒÄƒÄô‹MQè‡þÿƒÄ…À}'¡ð­=tƒÄôP貄þÿP‹EPƒÄôh @ë9ƒÄøh;@‹MQè†þÿ‰EøƒÄ…ÀuAƒÄôÿ5ð­èw„þÿP‹EPƒÄôh@è„þÿƒÄPjèŠÿÿƒÄ ƒÄô‹UüRèé\‹Mü‹9‹ó…ö„ü‹F‹Ø‹Uü;B|%ƒ=Ì©„߃Äôh@@èCŠÿÿƒÄéʃ~u*ƒ=Ì©„©ƒÄüP‹ÿ0ht@èŠÿÿƒÄé‹MøQ‹Ã+ÇPjWè?‡þÿ‹ûƒÄ‹F=t$‚^=„·=„,éKƒÄøÿv‹EPè‹ØƒÄôSè‰EìƒÄ öF uP‹UøRÿvWè‹øƒÄëƒÄôÿv ‹MìQ‹EøPÿvWè5‹øƒÄ ƒ=Ì©tƒÄô‹URÿvS‹ÿ0h @èJ‰ÿÿƒÄ ƒÄôS裃þÿƒÄô‹MìQè—ƒþÿÿEðƒÄ 騋‹‰EèƒÄôPèd‹ØƒÄöF uS‹EøPÿvWè÷‹øƒÄëƒÄôÿv S‹UøRÿvWè ‹øƒÄ ƒ=Ì©t‹MQÿv‹EèPhà@蹈ÿÿƒÄƒÄôSèƒþÿÿEôƒÄë'hú>‹UøRÿvW莋øƒÄë èGƒþÿ‹v…ö…þÿÿ‹×‹Mü+‹A;Ð}‹MøQ+ÂPjW蜅þÿƒÄƒÄô‹EøPèƒþÿƒÄô‹UüRè½ƒÄ ‹MôQ‹EðPhAj袇ÿÿeÈ[^_ÉÃU‹ìƒìWVS‹}‹] €;/uƒÄôSèéÜ€?/uhAh-h>h>èÖÇEü3ÉŠ9„ÒtŠ„Àt:Ðu €ú/t Aëæ€<9/u€</uA‰MüëÒ3ö]ü‰]ø€<9t€<9/uFA€<9uòƒÄôv‹}ø°ü¹ÿÿÿÿò®÷Ñ Pè‹ø3ɃÄ;Î}#»(A3ҋη(Af‰ŠCˆDƒÂIuè‹ÎƒÄø‹EøPIÇPè´‚þÿ‹ÇeØ[^_ÉÃU‹ìƒì WVS‹u‹þ°ü¹ÿÿÿÿò®÷ÑYÿˆEÿƒ} u&A$ð+à‹üƒÄøVWèo‚þÿ¡,A‰D;ü 0Aˆ;ë'A$ð+à‹üƒÄøVWèI‚þÿ¡1A‰;·5Af‰D;ƒÄ‹të‹[…ÛtƒÄøVÿ3èæþÿƒÄ…ÀuçÆEÿ€}ÿueƒÄøWVèû„þÿƒÄ…Àt/ƒÄôƒÄôÿ5ð­è€þÿPWVƒÄôh7Aè³þÿƒÄPjè°…ÿÿƒÄ0ƒÄôjèNj؃ÄôVè4‰¡t‰C‰teè[^_ÉÃU‹ìƒìWVS‹u‹} ‹]ÇEôÆEó"Š<"t<'uˆEóÇEôFƒÇþÿ yƒÄøS¾EóPèq‚þÿƒÄë ‹CŠUóˆÿCƒÄøSÿuèþÿEüPEøPWVè²ƒÄ …ÀtS‹Uø‹Eü+ÂPjR轂þÿƒÄ÷ƒ}ôtFÿ yƒÄøS¾EóPè‚þÿë ‹CŠUóˆÿC‹ÆeØ[^_ÉÃU‹ìƒì WVS‹uƒÄô‹EPè@‹Ð‹þ°ü¹ÿÿÿÿò®÷ÑD $ðƒÄ+à‹ÜV‹EPhTASè€þÿS‹EP‹E P‹EPèåþÿÿeè[^_ÉÃU‹ìWVS‹U‹u‹}‹ÊM 3Û;Ñs-Š<#t<&u»ë…Ûu ‰‰¸ë 3ÛB;ÑrÕ3À[^_ÉÃU‹ìƒì WVS‹}ƒ=ªu ƒÄôW錃Äøj?Wèå‹ØƒÄ…Ûtp‹÷‹Ö‹ú°ü¹ÿÿÿÿò®÷Ñ\YÿC$ð+à‹Ì‹Ô€>t Šuâ‹Â+Á;Ãth_Ah$ h>h>èñÆ‹Áë‹ÇƒÄôPè1eè[^_ÉÃU‹ì‹E=tr=t=të!¸”t븘t븜të ¸ të3ÀÉÃU‹ìƒìVS‹u‹] ƒþu¡@§…ÀtsƒÄøSPèºÿÿ‰Eü…Àtbëeƒ=@§uƒÄôjè©ÿÿ£@§ƒÄƒÄøSÿ5@§è†ÿÿ‰EüƒÄ…Àu0ƒÄôVèOÿÿÿ‰EüƒÄüEüPƒÄôSè,ƒÄPÿ5@§èáÿÿ3Àë‹eè[^ÉÃU‹ìƒìƒÄôÿuèG}þÿ3ÀÉÃU‹ìƒì¡@§…Àt(ƒÄüjh»PèmÿÿƒÄôÿ5@§è×ÿÿÇ@§ÉÃU‹ìƒìS‹]ƒÄôjèðÿÿSÿ5$ªƒÄôh€Aèì{þÿƒÄPjèéÿÿƒÄ ƒÄôjè„{þÿU‹ìƒìSƒÄôÿuèò€þÿ‹ØƒÄ…Ûu ƒÄôhœAè˜ÿÿÿ‹Ã‹]èÉÃU‹ìƒìS‹E‹U …ÀtƒÄøRPèÉ€þÿë ƒÄôRè«€þÿ‹ØƒÄ…Ûu ƒÄôh£AèQÿÿÿ‹Ã‹]èÉÃU‹ìƒìSƒÄôÿu蚀þÿ‹ØƒÄ…Ûu ƒÄôh«Aè ÿÿÿ‹Ã‹]èÉÃU‹ìƒìSƒÄôÿuè¾ÿÿÿ‹È‹Ñ€9t»à:¶ŠˆB€:uò‹Á‹]èÉÃU‹ìŠM 3À‹U€:t 8 u@B€:uõÉÃU‹ìƒì WVS‹uƒÄô‹] +ÞCPèãþÿÿ‹øƒÄüSVWèª{þÿÆ;‹Çeè[^_ÉÃU‹ìƒìWVS‹]ÇEü…ÛtŠ„Àu 3Àé 3ÿ‹óº‰Uø<,uXƒÄø‹EøÁàPWè°þÿÿ‹øƒÄøSVètÿÿÿ‹Uü‰—ÿEøB‰UüÇ—CƒÄ ¶ºà8öB@t C¶öB@uö‹ó‹UøëCŠ„ÀuƒÄø•PWèPþÿÿ‹øƒÄøSVèÿÿÿ‹Uü‰—ÇD—‹ÇeØ[^_ÉÃU‹ìƒìƒÄôÿuè/{þÿ‰EüƒÄ=ÿÿÿÿt.ƒÄôEüPè¶zþÿƒÄôÿ0ÿpÿph²Ah`§èœ{þÿ¸`§ë ¸`§Æ`§ÉÃU‹ìƒìƒÄôÿuèÓzþÿ‰EüƒÄ=ÿÿÿÿt>ƒÄôEüPèZzþÿ‹Ðÿ2ÿrÿrÿr ‹B@P‹BlPhÁAho§è0{þÿ¸o§ë ¸o§Æo§ÉÃU‹ìƒìS3Ûƒ=©uƒÄôhßAè•£©»ƒÄè7~þÿ…À}ƒÄôhèAè}þÿƒÄôjèlxþÿ…ÀtPƒÄøPƒÄôhBè§xþÿƒÄPè¾|þÿƒÄ…Ût"ƒÄøÿ5©ƒÄôh@BèxþÿƒÄPè˜|þÿƒÄƒÄôjèxþÿèÓ}þÿƒÄüh0ªhaBhcBèÌ}þÿƒÄüh@ªhmBhcBèµ}þÿƒÄ ƒÄühPªhmBhcBè›}þÿ‹]èÉÃU‹ìƒìS‹]‹E Uø‰B‰EøƒÄøRSè„}þÿƒÄ=ÿÿÿÿuƒÄôÿ5ð­è,xþÿPShoBjèÖ}ÿÿ‹]èÉÃU‹ììVS‹]3öƒÄø…xÿÿÿPSèHzþÿƒÄ…Àuc‹EŒ%ð= uTƒ=Ì©tƒÄøSh~Bè~ÿÿƒÄƒÄôSèÿyþÿ‹ðƒÄ…öt(ƒÄôÿ5ð­è¨wþÿPSƒÄôh BèIwþÿƒÄPjèF}ÿÿ‹Æ¥hÿÿÿ[^ÉÃU‹ìƒìƒÄøjÿuè½|þÿ÷ÐÁèÉÃU‹ì옃Äø…xÿÿÿPÿuè™yþÿ…Àu‹EŒ%ð=@•À%ÿë3ÀÉÃU‹ìƒì WVS‹]‹u …öt9ƒÄôƒÄôVè] ‹Ð‹û°ü¹ÿÿÿÿò®+ÑRèÏúÿÿ‹øƒÄ VShÃBWè¡xþÿëƒÄôSè'ûÿÿ‹øƒÄƒÄôWèEÿÿÿƒÄ…ÀtƒÄôWèUwþÿ3Àë‹Çeè[^_ÉÃU‹ìƒìVS‹u3ÛƒÄøSCVèaÿÿÿƒÄ…Àtîeè[^ÉÃU‹ìƒì WVS‹U3ö‹ú°ü¹ÿÿÿÿò®÷ÑA$ð+à‹üƒÄøRWèxþÿƒÄ€?/”À¶ØëCŠ;„Àt tƒÄôÿ3ƒÃèƒpþÿƒÄƒ;uëƒÄôVèrpþÿeè[^ÉÃU‹ìƒì WVS‹u‹} …öu‹Çël…ÿte‹…ÒtV3Àƒ>t @ƒ<†uù3Û …‰Mü…ÒtCƒ<ŸuùƒÄøDÁàPVèxóÿÿ‹ð‹UüÖƒÄüPWRèpþÿƒÄ ƒÄôWèçoþÿ‹Æeè[^_ÉÃU‹ìƒì WVS‹uƒÄôjèóÿÿ‹ø‹ÞƒÄô‹E Pèjóÿÿ‰ÇG…Ûu‹Çëƒ{t ‹vƒ~u÷‰~‹Ãeè[^_ÉÃU‹ìƒì WVS‹u‹] ƒÄôjè§òÿÿ‹øƒÄôSèóÿÿ‰‰w‹Çeè[^_ÉÃU‹ì‹U3É…Òt‹B‰J‹Ê‹Ð…Òuò‹ÁÉÃU‹ìƒìVS‹]‹u …Ût%ƒÄøVÿ3ènþÿƒÄ…Àu ¸ë ‹[…ÛuÝ3Àeè[^ÉÃU‹ìƒìVS‹u…öt ‹^ƒÄôÿ6èÓnþÿƒÄôVèÊnþÿ‹óƒÄ …öuáeè[^ÉÃU‹ìƒìVS‹u‹] ƒÄøSVè¨ÿÿƒÄ…ÀuƒÄühÉBƒÄôSè<òÿÿƒÄPVèöÿÿeè[^ÉÃU‹ìƒìƒÄøÿu ÿuèhÿÿÉÃU‹ìƒìƒÄôÿuèKnþÿ3ÀÉÃU‹ìƒìS‹]ƒÄüjhüÉSèvÿÿƒÄôSèåÿÿ‹]èÉÃU‹ìƒìS‹] ƒÄôÿuènþÿƒÄôSèþmþÿ3À‹]èÉÃU‹ìƒìƒÄüjh<Êÿuè(ÿÿÉÃU‹ìƒì WVS¾ §‹E‰Eü€8-uÆ §-¾¡§@‰Eü‹}ü°ü¹ÿÿÿÿò®÷ÑI‹Á÷%ÌBÑêR‹Ñ+Ð3Û;Ú}‹MüŠ ˆFC;Ú|ò‹Ë3Û‹Eü€<t0¿VUUU‹Ã÷ï‹ÃÁø+ÐR;Øu…ÉtÆ,F‹UüŠˆFCA€<uÕƸ §[^_ÉÃU‹ìƒì$SƒÄøÿu]èSèƒÄôSè9ÿÿÿ‹]ØÉÃU‹ìƒìWVS‹}‹] ‹uÇEüjj VSèÙƒÄ0‹Müˆ9A‰Müjj VS觃ċ؋ò ÆuЋEüÁèEüÑø…À~$‰Eø‹]üK¾ŠD7ÿ‹ÎŠˆT7ÿˆKF;Mø|é‹EüÆ8eØ[^_ÉÃU‹ìì”SƒÄü‹E‹U RP]€SèRÿÿÿƒÄôSè}þÿÿ‹hÿÿÿÉÃU‹ìVS‹u¹…ö}÷Þ¹»gfff‹Æ÷ëÁú‹ÆÁø‹ò+ð…ö~A‹Æ÷ëÁú‹ÆÁø+Ћò…öë‹Á[^ÉÃU‹ìVS‹u‹] …Û}Æ-F÷Ûƒû ŽæƒûcŽ¼û王û'ŽTûŸ†Žû?BŽÝû–˜ŽŸûÿàõ~bûÿÉš;~"º¡/¸D‹Â÷ëÁú‹ÃÁø+ЊÂ0ˆFiÂÊš;+ع‰;æU‹Á÷ë‹ÊÁù‹ÓÁú+ÊŠÁ0ˆF‹ÑÁâ+Ñ‹ÂÁà+ÂÁ€€Áà+عkÊ_k‹Á÷ë‹ÊÁù‹ÓÁú+ÊŠÁ0ˆF‹ÑÁâ+Ñ‹ÂÁà+ÂÁ€Áà+عƒÞC‹Á÷ë‹ÊÁù‹ÓÁú+ÊŠÁ0ˆF‹ÑÁâ+Ñ‹ÂÁà+ÂÁÁà+ع‰µø‹Á÷ë‹ÊÁù ‹ÓÁú+ÊŠÁ0ˆF‹ÑÁâ+Ñ‘€€Áà+ع­‹Ûh‹Á÷ë‹ÊÁù ‹ÓÁú+ÊŠÁ0ˆF‹ÑÁâ+Ñ‘€Áà+عÓMb‹Á÷ë‹ÊÁù‹ÓÁú+ÊŠÁ0ˆF‹ÑÁâ+Ñ‘Áà+غ…ëQ‹Â÷ëÁú‹ÃÁø+ЊÂ0ˆF’€Áà+غgfff‹Â÷ëÁú‹ÃÁø+ЊÂ0ˆF’À+Ø€Ã0ˆFÆ‹Æ[^ÉÃU‹ìƒìƒÄôjèíÿÿÉÃU‹ìƒìSèàÿÿÿ‹ØƒÄôSè‹Ã‹]èÉÃU‹ìƒìƒÄôÿuè£iþÿÉÃU‹ìƒìVS‹uƒÄøj]øSè—nþÿ‹Eø‰‹C‰Feè[^ÉÃU‹ìƒìWVS‹uƒÄøj]øSèjnþÿ‹‹Mø+È‹ÁÁà+Á<‹N‹[+Ù¹ÓMb‹Ã÷éÁú‹ËÁù+ÑúeØ[^_ÉÃU‹ì¸ÉÃU‹ìƒì WVS‹]‹ó3À€;t8Š€ú&t"€úuë€ú"uë €ú uC@€;u˃Äô@Pèùëÿÿ‹ø‹Þ‹Ï€;„ŠBà¾À=wqÿ$…ÐBÆ&AÆaAÆmAÆpAÆ;ëUÆ&A‹ÑA°g€;ÿuô[^ÉÃU‹ìƒìSè[ÃPq[ÉÃèsjþÿè›ÿÿÿÂèÃiþÿÂconnection_host_name == NULLconnect.c%s:%u: failed assertion `%s' connection_host_name != NULLConnecting to %s[%s]:%hu... Connecting to %s:%hu... connected. Created socket %d. failed: %s. Closing fd %d Master socket fd %d bound. Created socket fd %d. Deleted old cookie (to be replaced.) permanentnonpermanent Stored cookie %s %d %s %s %d %s %s %s res != 0cookies.c%s:%u: failed assertion `%s' Discarded old cookie. name_b != NULL && name_e != NULLdomainpathexpiresmax-age%lfsecureð¿Error in Set-Cookie, field `%s'Syntax error in Set-Cookie at character `%c'. Syntax error in Set-Cookie: premature end of string. TN´NOlOÌO$P4PhP¤P-Q-Q.int.mil.gov.org.net.edu.comcdm: 1 2 3 4 5 6Attempt to fake the domain: %s, %s Attempt to fake the path: %s, %s p != NULLocnt == countCookie: pos == result_sizerCannot open cookies file `%s': %s TRUE%luFALSE%s %s %s %s %lu %s %s Saving cookies to %s. w# HTTP cookie file. # Generated by Wget on %s. # Edit at your own risk. Error writing to `%s': %s Error closing `%s': %s Done saving cookies. bytecon != NULLftp.c%s:%u: failed assertion `%s' con->target != NULL!((cmd & DO_LIST) && (cmd & DO_RETR))(cmd & (DO_LIST | DO_CWD | DO_RETR | DO_LOGIN)) != 0user && passwdLogging in as %s ... Error in server response, closing control connection. Closing fd %d Error in server greeting. Write failed, closing control connection. The server refuses login. Login incorrect. Logged in! ==> SYST ... Server error, can't determine system type. done. ==> PWD ... /Initial VMS directory not in the form [...]! Preprocessing the initial VMS directory old = '%s' new = '%s' done. ==> TYPE %c ... Unknown type `%c', closing control connection. done. ==> CWD not needed. changing working directory %s%s%sPrepended initial PWD to relative path: old: '%s' new: '%s' *ntarget == '/'Changed file name to VMS syntax: Unix: '%s' VMS: '%s' ==> CWD %s ... No such directory `%s'. ==> CWD not required. ==> SIZE %s ... ==> PASV ... Cannot initiate PASV transfer. Cannot parse PASV response. couldn't connect to %s:%hu: %s ==> PORT ... socket: %s Bind error (%s). Invalid PORT. ==> REST %ld ... REST failed; will not truncate `%s'. REST failed, starting from scratch. ==> RETR %s ... No such file `%s'. ==> LIST ... .No such file or directory `%s'. Lying FTP server found, adjusting. accept: %s abwb%s: %s Length: %s [%s to go] (unauthoritative) %s: %s, closing control connection. %s (%s) - Data connection: %s; %s (%s) - Control connection closed. Data transfer aborted. r%s ˜k(k¸jÀkÀkÀkÀkiÀkðiÀkÀkÀkÀkÀkÀkÀkÀkÀkÀkÀkÀkÀkÀkÀkÀkÀkÀkÀkÀkÀkÀkÀkÀkÀkÀkÀkÀkÀkÀkXjèvàvàvàvàvàvàvÐuàvàvàvàvàvàvàvàvàvàvàvàvàvàvàv´v˜vàvàvàvàvàvàvàvàvàvàvàvàvàvàvàv0v¸xôyôyôyôyôy,y,yôy,yôyôyôyüyôyôy|yôyôyôy(xôyôyôyôyôyôyôyôyôyôyôyôyôyôyôyôyôyôyôyôyôyôyôyôyôyôyôyôyôyôyôyôy˜xFile `%s' already there, not retrieving. (try:%2d)--%s-- %s %s => `%s' %s (%s) - `%s' saved [%ld] %s URL: %s [%ld] -> "%s" [%d] Removing file due to --delete-after in ftp_loop_internal(): Removing %s. unlink: %s ¸‡Ô‡Ô‡ô‡¸‡ô‡ô‡Ô‡Ô‡ô‡Ô‡Ô‡ô‡ô‡ô‡¸‡Ô‡Ô‡¸‡ô‡Ô‡Ô‡ô‡Ô‡À‡ô‡ô‡¸‡¸‡ô‡ô‡ô‡ô‡ô‡ô‡ô‡ô‡Ô‡¸‡¸‡ô‡ü‡ô‡ô‡ô‡ô‡ô‡ô‡ô‡ô‡ô‡ô‡ô‡ô‡Ô‡.listingUsing `%s' as listing tmp file. Removed `%s'. Recursion depth %d exceeded max. depth %d. f != NULLRemote file no newer than local file `%s' -- not retrieving. Remote file is newer than local file `%s' -- retrieving. The sizes do not match (local %ld) -- retrieving. Invalid name of the symlink, skipping. Already have correct symlink %s -> %s Creating symlink %s -> %s symlink: %s Skipping directory `%s'. %s: unknown/unsupported file type. %s: corrupt time-stamp. Unrecognized permissions for %s. Will not retrieve dirs since depth is %d (max %d). %s%s%s/%sComposing new CWD relative to the initial directory. odir = '%s' f->name = '%s' newdir = '%s' Not descending to `%s' as it is excluded/not-included. Rejecting `%s'. No matches on pattern `%s'. Wrote HTML-ized index to `%s' [%ld]. Wrote HTML-ized index to `%s'. %s %s%s%s PASS--> %s --> PASS Turtle Power! --> %s USER331 opiekey 331 s/key %d,%d,%d,%d,%d,%dPORTPASVTYPECWDRESTRETRLISTSYSTVMSUNIXWINDOWS_NTMACOSPWD"SIZEtype=DecNovOctSepAugJulJunMayAprMarFebJanrb%s: %s total PLAINFILE; DIRECTORY; SYMLINK; UNKNOWN; implicit perms %0o; perms %0o; month: %s; day: %d; year: %d (no tm); time: %02d:%02d:%02d (no yr); -> link to: %s ... Ignoring `.' and `..'; trailing `/' on dir. trailing `@' on link. trailing `*' on exec. Skipping. Name: '%s' -:MYYYY/MM/DD HH:MM - %d/%02d/%02d %02d:%02d Timestamp: %ld Directory File, size %ld bytes wrong VMS permissons! p³³³³³³³³³³³³³³³³³³³³³³³³€³ˆ³³³³³³³³³³³³³x³³³³³€³DECNOVOCTSEPAUGJULJUNMAYAPRMARFEBJANfile name: '%s' .DIRFile Getting additional line empty line read, leaving listing parser confusing VMS listing item, leaving listing parser second token: '%s' day: '%s' nonsense in VMS listing, skipping this line date parsed YYYY/MM/DD HH:MM:SS - %d/%02d/%02d %02d:%02d:%02d ,)confusing VMS permissions, skipping line permissions: %s -> 0%o Unsupported listing type, trying Unix listing parser. wb%s%s%s@ �Index of /%s on %s:%d� 

  %d %s %02d %02d:%02d         time unknown       File        Directory   Link        Not sure    %s  (%s bytes)(nil)-> %s
store is `%s' POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c );Ok•Å[ÉWQñ Ý /?!"i,¿9Kaë~¥Ö½j‘× e7 CA×¥ä½ «Š©f!©í*‘Î7ŸŒH}P^å›zKdŸ¡5ÏU_ %/^k=ÇÝÏOG[é)è…6ûFšI\•«‘( QŠKšÛ5âƒ5¦Þƒ>n)#Ü5¡Fuë[ç~Tv¥>Ô™wQúÇ%s index >= al->faulty && index < al->counthost.c%s:%u: failed assertion `%s' index == al->faultycount > 0Releasing %p (new refcount %d). Deleting unused %p. Caching %s => %s Found %s in host_name_addresses_map (%p) Resolving %s... failed: %s. done. u->host != NULLHost not foundUnknown erroral->refcount == 1ltgtampquotnbspch == '\'' || ch == 0x22html-parse.c%s:%u: failed assertion `%s' ch == quote_charch == '-'!á!átß„ßØߌà¸àÌààà á àXàhàØàØà¬ß¬ßØà¬ß¬ß¬ß¬ß¬ß¬ß¬ß¬ß¬ß¬ß¬ß¬ß¬ß¬ß¬ß¬ß¬ß¬ßØà¬ß ß¬ß¬ß¬ß¬ß ß¬ß¬ß¬ß¬ß¬ßà¬ß¬ß¬ß¬ß¬ß¬ß¬ß¬ß¬ß¬ß¬ß¬ß¬ß¬ß¬ß¬ß˜ßthtdtablescriptoverlaymetalinklayerinputimgiframeframefigembedbodybgsoundbaseareaappletalowsrcbackgroundsrccodehrefcontentnamehttp-equivrel%s: no base, merge will use "%s". %s: Cannot resolve incomplete link %s. %s: link "%s" doesn't parse. %s: merge("%s", "%s") -> %s %s: merged link "%s" doesn't parse. appending "%s" to urlpos. first != -1html-url.c%s:%u: failed assertion `%s' stylesheetshortcut iconrefreshrobotsnonenofollowtagid != -1%s: %s Loaded %s (size %ld). no-follow in %s: %d HTTP/bytesnoneKeep-AliveInvalidating fd %d from further reuse. Closing fd %d pc_last_host_ip == NULLhttp.c%s:%u: failed assertion `%s' pc_last_host_ip != NULLRegistered fd %d for persistent reuse. *hs->local_file != NULLReusing connection to %s:%hu. Reusing fd %d. HEADGETReferer: %s Pragma: no-cache Range: bytes=%ld- Wget/%sAuthorizationProxy-Authorization:%dConnection: Keep-Alive */*%s %s HTTP/1.0 User-Agent: %s Host: %s%s Accept: %s %s%s%s%s%s%s%s%s ---request begin--- %s---request end--- Failed writing HTTP request: %s. ProxyHTTP%s request sent, awaiting response... End of file while parsing headers. Read error (%s) in headers. No data receivedMalformed status line(no description) %2d %s%2d %sContent-LengthContent-TypeLocationLast-ModifiedSet-CookieWWW-AuthenticateAccept-RangesContent-RangeConnectioninhibit_keep_alive == 0Authorization failed. Unknown authentication scheme. Basic [following]unspecifiedLocation: %s%s text/html.htm.html The file is already fully retrieved; nothing to do. Continued download failed on this file, which conflicts with `-c'. Refusing to truncate existing file `%s'. Length: (%s to go)ignored [%s] abwb%s: %s Warning: wildcards not supported in HTTP. File `%s' already there, will not retrieve. htmlhtm.orig (try:%2d)--%s-- %s %s => `%s' Cannot write to `%s' (%s). Unable to establish SSL connection. ERROR: Redirection (%d) without location. %s: %s ERROR %d: %s. Last-modified header missing -- time-stamps turned off. Last-modified header invalid -- time-stamp ignored. Server file no newer than local file `%s' -- not retrieving. The sizes do not match (local %ld) -- retrieving. Remote file is newer, retrieving. %d %s %s (%s) - `%s' saved [%ld/%ld] %s URL:%s [%ld/%ld] -> "%s" [%d] %s (%s) - `%s' saved [%ld] %s URL:%s [%ld] -> "%s" [%d] %s (%s) - Connection closed at byte %ld. %s (%s) - `%s' saved [%ld/%ld]) %s (%s) - Connection closed at byte %ld/%ld. %s (%s) - Read error at byte %ld (%s).%s (%s) - Read error at byte %ld/%ld (%s). øÌÌTø¬ÌÌÌø $ÌÌøøÌø%a %b %d %T %Y%a, %d-%b-%Y %T%A, %d-%b-%y %T%a, %d %b %Y %T%s:%s%s: Basic %s nonceopaquerealm:Authorization: Digest username="%s", realm="%s", nonce="%s", uri="%s", response="%s", opaque="" DigestNTLMwaitretrywaitverboseuseragentuseproxytriestimestampingtimeoutspiderspanhostsserverresponsesaveheaderssavecookiesrobotsretrsymlinksremovelistingrelativeonlyrejectrefererrecursivereclevelrandomwaitquotaquietproxyuserproxypasswdprogresspasswdpassiveftppagerequisitesoutputdocumentnumtriesnoproxynoparentnoclobbernetrcmirrorloginlogfileloadcookieslimitratekilllongerinputincludedirectoriesignoretagsignorelengthhttpuserhttpsproxyhttpproxyhttppasswdhttpkeepalivehtmlifyhtmlextensionheaderglobftpproxyforcehtmlfollowtagsfollowftpexcludedomainsexcludedirectoriesdotstyledotspacingdotsinlinedotbytesdomainsdirstructdirprefixdeleteafterdebugcutdirscookiesconvertlinkscontinuecachebindaddressbasebackupsbackupconvertedbackgroundalwaysrestaddhostdiraccept.anonymous-wget@no_proxyHOMEWGETRC%s: %s: %s. %s/.wgetrcrb%s: Cannot read %s (%s). %s: Error in %s at line %d. /opt/csw/etc/wgetrc%s: Warning: Both system and user wgetrc point to `%s'. %s: BUG: unknown command `%s', value `%s'. %s: %s: Cannot convert `%s' to an IP address. onoff%s: %s: Please specify on or off. alwaysnever%s: %s: Please specify always, on, off, or never. %s: %s: Invalid specification `%s'. inf%s: Invalid specification `%s' %s: %s: Invalid progress type `%s'. awwget-log %s received, redirecting output to `%s'. %s: %s; disabling logging. /opt/csw/share/localewgetUsage: %s [OPTION]... [URL]... GNU Wget %s, a non-interactive network retriever. Mandatory arguments to long options are mandatory for short options too. Startup: -V, --version display the version of Wget and exit. -h, --help print this help. -b, --background go to background after startup. -e, --execute=COMMAND execute a `.wgetrc'-style command. Logging and input file: -o, --output-file=FILE log messages to FILE. -a, --append-output=FILE append messages to FILE. -d, --debug print debug output. -q, --quiet quiet (no output). -v, --verbose be verbose (this is the default). -nv, --non-verbose turn off verboseness, without being quiet. -i, --input-file=FILE download URLs found in FILE. -F, --force-html treat input file as HTML. -B, --base=URL prepends URL to relative links in -F -i file. --sslcertfile=FILE optional client certificate. --sslcertkey=KEYFILE optional keyfile for this certificate. --egd-file=FILE file name of the EGD socket. Download: --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). -O --output-document=FILE write documents to FILE. -nc, --no-clobber don't clobber existing files or use .# suffixes. -c, --continue resume getting a partially-downloaded file. --progress=TYPE select progress gauge type. -N, --timestamping don't re-retrieve files unless newer than local. -S, --server-response print server response. --spider don't download anything. -T, --timeout=SECONDS set the read timeout to SECONDS. -w, --wait=SECONDS wait SECONDS between retrievals. --waitretry=SECONDS wait 1...SECONDS between retries of a retrieval. --random-wait wait from 0...2*WAIT secs between retrievals. -Y, --proxy=on/off turn proxy on or off. -Q, --quota=NUMBER set retrieval quota to NUMBER. --limit-rate=RATE limit download rate to RATE. Directories: -nd --no-directories don't create directories. -x, --force-directories force creation of directories. -nH, --no-host-directories don't create host directories. -P, --directory-prefix=PREFIX save files to PREFIX/... --cut-dirs=NUMBER ignore NUMBER remote directory components. HTTP options: --http-user=USER set http user to USER. --http-passwd=PASS set http password to PASS. -C, --cache=on/off (dis)allow server-cached data (normally allowed). -E, --html-extension save all text/html documents with .html extension. --ignore-length ignore `Content-Length' header field. --header=STRING insert STRING among the headers. --proxy-user=USER set USER as proxy username. --proxy-passwd=PASS set PASS as proxy password. --referer=URL include `Referer: URL' header in HTTP request. -s, --save-headers save the HTTP headers to file. -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. --no-http-keep-alive disable HTTP keep-alive (persistent connections). --cookies=off don't use cookies. --load-cookies=FILE load cookies from FILE before session. --save-cookies=FILE save cookies to FILE after session. FTP options: -nr, --dont-remove-listing don't remove `.listing' files. -g, --glob=on/off turn file name globbing on or off. --passive-ftp use the "passive" transfer mode. --retr-symlinks when recursing, get linked-to files (not dirs). Recursive retrieval: -r, --recursive recursive web-suck -- use with care! -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). --delete-after delete files locally after downloading them. -k, --convert-links convert non-relative links to relative. -K, --backup-converted before converting file X, back up as X.orig. -m, --mirror shortcut option equivalent to -r -N -l inf -nr. -p, --page-requisites get all images, etc. needed to display HTML page. Recursive accept/reject: -A, --accept=LIST comma-separated list of accepted extensions. -R, --reject=LIST comma-separated list of rejected extensions. -D, --domains=LIST comma-separated list of accepted domains. --exclude-domains=LIST comma-separated list of rejected domains. --follow-ftp follow FTP links from HTML documents. --follow-tags=LIST comma-separated list of followed HTML tags. -G, --ignore-tags=LIST comma-separated list of ignored HTML tags. -H, --span-hosts go to foreign hosts when recursive. -L, --relative follow relative links only. -I, --include-directories=LIST list of allowed directories. -X, --exclude-directories=LIST list of excluded directories. -np, --no-parent don't ascend to the parent directory. Mail bug reports and suggestions to . waitretrywaituse-proxyrefereruser-agenttriestimeoutsave-cookiesrejectquotaproxy-userproxy-passwdproxyprogressoutput-fileoutput-documentnoload-cookieslimit-ratelevelinput-fileinclude-directoriesignore-tagshttp-userhttp-passwdhtmlifyheaderglobfollow-tagsexclude-domainsexclude-directoriesexecutedot-styledomainsdirectory-prefixcut-dirscookiescachebind-addressbasebackupsappend-outputacceptversionverbosetimestampingspiderspan-hostsserver-responsesave-headersretr-symlinksrelativerecursiverandom-waitquietpage-requisitespassive-ftpnon-verboseno-parentno-http-keep-aliveno-host-lookupno-host-directoriesno-directoriesno-clobbermirrorignore-lengthhtml-extensionhelpforce-htmlforce-hierforce-directoriesfollow-ftpdont-remove-listingdelete-afterdebugconvert-linkscontinuebackup-convertedbackgroundhpVqvdkKsxmNWrHSLcFbEY:G:g:T:U:O:l:n:i:o:a:t:D:A:R:P:B:e:Q:X:I:w:C:onnoparentdeleteafterretrsymlinksignorelengthpassiveftpnoclobberfollowftpcutdirsoffdirstructaddhostdirremovelistingbindaddresshttpkeepaliverandomwaithtmlextensionforcehtmlspanhostsbackupconvertedconvertlinksrelativeonlypagerequisitesserverresponsesaveheadersGNU Wget %s Copyright (C) 1995, 1996, 1997, 1998, 2000, 2001 Free Software Foundation, Inc. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. Originally written by Hrvoje Niksic . httpuserhttppasswddotstyleexcludedomainsproxyuserproxypasswdfollowtagsloadcookiessavecookieslimitratelogfile%s: %s: invalid command ignoretagsincludedirectoriesinputreclevel%s: illegal option -- `-n%c' Try `%s --help' for more options. outputdocumentdirprefixuseragentexcludedirectoriesuseproxyCan't be verbose and quiet at the same time. Can't timestamp and not clobber old files at the same time. %s: missing URL solaris2.8DEBUG output created by Wget %s on %s. abwbRemoving file due to --delete-after in main(): Removing %s. unlink: %s No URLs found in %s. FINISHED --%s-- Downloaded: %s bytes in %d files Download quota (%s bytes) EXCEEDED! àJ KˆGÄGØGìG„D˜D¤H¬DÌH KÐDøD K E JHJXJhJHExJ˜J˜E K¸JÈJ K K K K K K KœGHD\DpDH K¸HÀDàH KäDôH EI4J4EpE„E\EˆJ K F¨J F K K K K K K K K4FHF\FCCpF„F0CDCXClC˜F€C”C¬FÀF¨C¼CÐCäCøC KÔFèFüF K D DtG K KG$G8GLG`G4DDI¬I¬I¬I¬I¬I¬I¬I¬I¬I¬I¬I¬I¬I¬I¬I¬I¬I¬I¬I¬I¬I¬I¬I¬I¬I¬IdITI¬I¬I¬I¬I¬I¬I”I¬I¬I¬I¬I„I¬ItI¬I¬I¬I4ISIGUSR1WTF?!SIGHUP.netrc%s/%sr%s: Cannot read %s (%s). loginpasswordmacdefaccount%s: %s:%d: warning: "%s" token appears before any machine name defaultmachine%s: %s:%d: unknown token "%s" VüUlUìU˜UÀUbardot %*s[ skipping %dK ] %5ldK ,dp->dots < opt.dots_in_lineprogress.c%s:%u: failed assertion `%s' %3d%%Y@ %s. defaultbinarymegagigaInvalid dot style specification `%s'; leaving unchanged. percentage <= 100%2d%% 100% dlsz <= progress_size %-11sG/sM/sK/sB/s %7.2f%s --.--K/s ETA --:--%d:%02d:%02d%02d:%02d ETA --:--p - bp->buffer <= bp->widthY@@@ TERMforceemacsEnqueuing %s at depth %d Queue count %d, maxcount %d. Dequeuing %s at depth %d %s: %s. Already downloaded "%s", reusing it from "%s". Not descending further; at depth %d, max. %d. url_parsed != NULLrecur.c%s:%u: failed assertion `%s' --delete-afterrecursive rejection criteriaRemoving file due to %s in recursive_retrieve(): Removing %s. Removing %s since it should be rejected. unlink: %s Deciding whether to enqueue "%s". Already on the black list. Not following non-HTTP schemes. It doesn't really look like a relative link. The domain was not accepted. Going to "%s" would escape "%s" with no_parent on. %s (%s) is excluded/not-included. htmlhtm%s (%s) does not match acc/rej rules. This is not the same hostname as the parent's (%s and %s). Not following %s because robots.txt forbids it. Decided to load it. Decided NOT to load it. orig_parsed != NULLnew_parsed != NULLRedirection "%s" failed the test. /index.htmlfile != NULLApparently %s has been removed. Scanning %s (from %s) will convert url %s to local %s will convert url %s to complete Converted %d files in %.2f seconds. @@wgetj == cntres.c%s:%u: failed assertion `%s' !EOL (p)Ignoring malformed line %duser-agentallowdisallowIgnoring unknown field at line %dCannot open %s: %sAllowingRejecting%s path %s because of rule `%s'. /robots.txtLoading robots.txt; please ignore errors. deferring a %ld ms sleep (%ld/%ld) until later. sleeping %ld ms @@GB/sMB/sKB/sB/s%7.2f %s%.2f %smsecs >= 0retr.c%s:%u: failed assertion `%s' bytes >= 0@@@0AP?ÐA°>>%s: %s. Could not find proxy host. Error parsing proxy URL %s: %s. Error in proxy URL %s: Must be HTTP. htmlhtmmynewloc != NULL%d redirections exceeded. %s: Redirection cycle detected. Removing file due to --delete-after in retrieve_from_file(): Removing %s. unlink: %s Giving up. Retrying. sleep_between_retrievals: norm=%ld,fuzz=%ld,sleep=%d CBBBBQ00000000000000000000000000000000  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~€‚ƒ„…†‡ˆ‰Š‹ŒŽ‘’“”•–—˜™š›œžŸ ¡¢£¤¥¦§¨©ª«¬­®¯°±²³´µ¶·¸¹º»¼½¾¿ÀÁÂÃÄÅÆÇÈÉÊËÌÍÎÏÐÑÒÓÔÕÖ×ØÙÚÛÜÝÞßàáâãäåæçèéêëìíîïðñòóôõö÷øùúûüýþÿ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~€‚ƒ„…†‡ˆ‰Š‹ŒŽ‘’“”•–—˜™š›œžŸ ¡¢£¤¥¦§¨©ª«¬­®¯°±²³´µ¶·¸¹º»¼½¾¿ÀÁÂÃÄÅÆÇÈÉÊËÌÍÎÏÐÑÒÓÔÕÖ×ØÙÚÛÜÝÞßàáâãäåæçèéêëìíîïðñòóôõö÷øùúûüýþÿftp://http://p2 - newstr == newlenurl.c%s:%u: failed assertion `%s' /?@ftp://%shttp://%sInvalid user nameBad port numberEmpty hostUnsupported schemeNo error:/;?#/;?#;?#?##*p == 0error_code >= 0 && error_code < ARRAY_SIZE (parse_errors)%s: %s Loaded %s (size %ld). %s: Invalid URL %s: %s %s.%dRemoving %s because of directory danger! %s: %s%s/%s/%s%s%sindex.html??;#scheme_str != NULL*password*p - result == sizehttp_proxyftp_proxyConverting %s... nothing to do. Cannot convert links in %s: %s Unable to delete `%s': %s wbSomething strange is going on. Please investigate.Skipping %s at position %d. TO_RELATIVE: %s to %s at position %d in %s. TO_COMPLETE: to %s at position %d in %s. %d-%d *s1 != '/'../orig.origCannot back up %s as %s: %s %d; URL=%sto - newname == fsqlen%s: %s: Not enough memory. mallocreallocstrdup%02d:%02d:%02d%04d-%02d-%02d %02d:%02d:%02dwget-logforkContinuing in background, pid %d. Output will be written to `%s'. r/dev/nullwutime(%s): %s Unlinking %s (symlink). Failed to unlink symlink `%s': %s %s.%d1«ªªªÐ,ÐøÏ,Ð,Ð,ÐÄÏ,Ð,Ð,Ð,Ð,Ð,Ð,Ð,Ð,Ð,Ð,Ð,Ð,Ð,Ð,Ð,Ð,Ð,Ð,Ð,Ð,ÐÜÏ,ÐÜÏ?1.8.2(Gî6þ677.7>7N7^7n7~7Ž7ž7®7¾7Î7Þ7î7þ788.8>8N8^8n8~8Ž8ž8®8¾8Î8Þ8î8þ899.9>9N9^9n9~9Ž9ž9®9¾9Î9Þ9î9þ9::.:>:N:^:n:~:Ž:ž:®:¾:Î:Þ:î:þ:;;.;>;N;^;n;~;Ž;ž;®;¾;Î;Þ;î;þ;<<.<><N<^<n<~<Ž<ž<®<¾<Î<Þ<î<þ<==.=>=N=^=n=~=Ž=ž=¬¸ÇÓ Ô PÔèà! Ýð  øýÿo‡ˆþÿÿoÀ2ÿÿÿo`x3@3˜üýÿoûÿÿo`E´tÿÿÿÿ¢×טד׎׉ׄ×0é#éÌéÈéÄéÀé¼é¸é´é°é¬é¨é¤é épìlìhìdì`ì\ìXìTìPìLìHìDìÌéÈéÄéÀé¼é¸é´é°é¬é¨é¤é éAABEACEACTADADAADDAGOAIDAIMAIRALLALPAMAMYANANAANDANNANTANYAPEAPSAPTARCAREARKARMARTASASHASKATATEAUGAUKAVEAWEAWKAWLAWNAXAYEBADBAGBAHBAMBANBARBATBAYBEBEDBEEBEGBENBETBEYBIBBIDBIGBINBITBOBBOGBONBOOBOPBOWBOYBUBBUDBUGBUMBUNBUSBUTBUYBYBYECABCALCAMCANCAPCARCATCAWCODCOGCOLCONCOOCOPCOTCOWCOYCRYCUBCUECUPCURCUTDABDADDAMDANDARDAYDEEDELDENDESDEWDIDDIEDIGDINDIPDODOEDOGDONDOTDOWDRYDUBDUDDUEDUGDUNEAREATEDEELEGGEGOELIELKELMELYEMENDESTETCEVAEVEEWEEYEFADFANFARFATFAYFEDFEEFEWFIBFIGFINFIRFITFLOFLYFOEFOGFORFRYFUMFUNFURGABGADGAGGALGAMGAPGASGAYGEEGELGEMGETGIGGILGINGOGOTGUMGUNGUSGUTGUYGYMGYPHAHADHALHAMHANHAPHASHATHAWHAYHEHEMHENHERHEWHEYHIHIDHIMHIPHISHITHOHOBHOCHOEHOGHOPHOTHOWHUBHUEHUGHUHHUMHUTIICYIDAIFIKEILLINKINNIOIONIQIRAIREIRKISITITSIVYJABJAGJAMJANJARJAWJAYJETJIGJIMJOJOBJOEJOGJOTJOYJUGJUTKAYKEGKENKEYKIDKIMKINKITLALABLACLADLAGLAMLAPLAWLAYLEALEDLEELEGLENLEOLETLEWLIDLIELINLIPLITLOLOBLOGLOPLOSLOTLOULOWLOYLUGLYEMAMACMADMAEMANMAOMAPMATMAWMAYMEMEGMELMENMETMEWMIDMINMITMOBMODMOEMOOMOPMOSMOTMOWMUDMUGMUMMYNABNAGNANNAPNATNAYNENEDNEENETNEWNIBNILNIPNITNONOBNODNONNORNOTNOVNOWNUNUNNUTOOAFOAKOAROATODDODEOFOFFOFTOHOILOKOLDONONEORORBOREORROSOTTOUROUTOVAOWOWEOWLOWNOXPAPADPALPAMPANPAPPARPATPAWPAYPEAPEGPENPEPPERPETPEWPHIPIPIEPINPITPLYPOPODPOEPOPPOTPOWPROPRYPUBPUGPUNPUPPUTQUORAGRAMRANRAPRATRAWRAYREBREDREPRETRIBRIDRIGRIMRIORIPROBRODROERONROTROWROYRUBRUERUGRUMRUNRYESACSADSAGSALSAMSANSAPSATSAWSAYSEASECSEESENSETSEWSHESHYSINSIPSIRSISSITSKISKYSLYSOSOBSODSONSOPSOWSOYSPASPYSUBSUDSUESUMSUNSUPTABTADTAGTANTAPTARTEATEDTEETENTHETHYTICTIETIMTINTIPTOTOETOGTOMTONTOOTOPTOWTOYTRYTUBTUGTUMTUNTWOUNUPUSUSEVANVATVETVIEWADWAGWARWASWAYWEWEBWEDWEEWETWHOWHYWINWITWOKWONWOOWOWWRYWUYAMYAPYAWYEYEAYESYETYOUABEDABELABETABLEABUTACHEACIDACMEACREACTAACTSADAMADDSADENAFARAFROAGEEAHEMAHOYAIDAAIDEAIDSAIRYAJARAKINALANALECALGAALIAALLYALMAALOEALSOALTOALUMALVAAMENAMESAMIDAMMOAMOKAMOSAMRAANDYANEWANNAANNEANTEANTIAQUAARABARCHAREAARGOARIDARMYARTSARTYASIAASKSATOMAUNTAURAAUTOAVERAVIDAVISAVONAVOWAWAYAWRYBABEBABYBACHBACKBADEBAILBAITBAKEBALDBALEBALIBALKBALLBALMBANDBANEBANGBANKBARBBARDBAREBARKBARNBARRBASEBASHBASKBASSBATEBATHBAWDBAWLBEADBEAKBEAMBEANBEARBEATBEAUBECKBEEFBEENBEERBEETBELABELLBELTBENDBENTBERGBERNBERTBESSBESTBETABETHBHOYBIASBIDEBIENBILEBILKBILLBINDBINGBIRDBITEBITSBLABBLATBLEDBLEWBLOBBLOCBLOTBLOWBLUEBLUMBLURBOARBOATBOCABOCKBODEBODYBOGYBOHRBOILBOLDBOLOBOLTBOMBBONABONDBONEBONGBONNBONYBOOKBOOMBOONBOOTBOREBORGBORNBOSEBOSSBOTHBOUTBOWLBOYDBRADBRAEBRAGBRANBRAYBREDBREWBRIGBRIMBROWBUCKBUDDBUFFBULBBULKBULLBUNKBUNTBUOYBURGBURLBURNBURRBURTBURYBUSHBUSSBUSTBUSYBYTECADYCAFECAGECAINCAKECALFCALLCALMCAMECANECANTCARDCARECARLCARRCARTCASECASHCASKCASTCAVECEILCELLCENTCERNCHADCHARCHATCHAWCHEFCHENCHEWCHICCHINCHOUCHOWCHUBCHUGCHUMCITECITYCLADCLAMCLANCLAWCLAYCLODCLOGCLOTCLUBCLUECOALCOATCOCACOCKCOCOCODACODECODYCOEDCOILCOINCOKECOLACOLDCOLTCOMACOMBCOMECOOKCOOLCOONCOOTCORDCORECORKCORNCOSTCOVECOWLCRABCRAGCRAMCRAYCREWCRIBCROWCRUDCUBACUBECUFFCULLCULTCUNYCURBCURDCURECURLCURTCUTSDADEDALEDAMEDANADANEDANGDANKDAREDARKDARNDARTDASHDATADATEDAVEDAVYDAWNDAYSDEADDEAFDEALDEANDEARDEBTDECKDEEDDEEMDEERDEFTDEFYDELLDENTDENYDESKDIALDICEDIEDDIETDIMEDINEDINGDINTDIREDIRTDISCDISHDISKDIVEDOCKDOESDOLEDOLLDOLTDOMEDONEDOOMDOORDORADOSEDOTEDOUGDOURDOVEDOWNDRABDRAGDRAMDRAWDREWDRUBDRUGDRUMDUALDUCKDUCTDUELDUETDUKEDULLDUMBDUNEDUNKDUSKDUSTDUTYEACHEARLEARNEASEEASTEASYEBENECHOEDDYEDENEDGEEDGYEDITEDNAEGANELANELBAELLAELSEEMILEMITEMMAENDSERICEROSEVENEVEREVILEYEDFACEFACTFADEFAILFAINFAIRFAKEFALLFAMEFANGFARMFASTFATEFAWNFEARFEATFEEDFEELFEETFELLFELTFENDFERNFESTFEUDFIEFFIGSFILEFILLFILMFINDFINEFINKFIREFIRMFISHFISKFISTFITSFIVEFLAGFLAKFLAMFLATFLAWFLEAFLEDFLEWFLITFLOCFLOGFLOWFLUBFLUEFOALFOAMFOGYFOILFOLDFOLKFONDFONTFOODFOOLFOOTFORDFOREFORKFORMFORTFOSSFOULFOURFOWLFRAUFRAYFREDFREEFRETFREYFROGFROMFUELFULLFUMEFUNDFUNKFURYFUSEFUSSGAFFGAGEGAILGAINGAITGALAGALEGALLGALTGAMEGANGGARBGARYGASHGATEGAULGAURGAVEGAWKGEARGELDGENEGENTGERMGETSGIBEGIFTGILDGILLGILTGINAGIRDGIRLGISTGIVEGLADGLEEGLENGLIBGLOBGLOMGLOWGLUEGLUMGLUTGOADGOALGOATGOERGOESGOLDGOLFGONEGONGGOODGOOFGOREGORYGOSHGOUTGOWNGRABGRADGRAYGREGGREWGREYGRIDGRIMGRINGRITGROWGRUBGULFGULLGUNKGURUGUSHGUSTGWENGWYNHAAGHAASHACKHAILHAIRHALEHALFHALLHALOHALTHANDHANGHANKHANSHARDHARKHARMHARTHASHHASTHATEHATHHAULHAVEHAWKHAYSHEADHEALHEARHEATHEBEHECKHEEDHEELHEFTHELDHELLHELMHERBHERDHEREHEROHERSHESSHEWNHICKHIDEHIGHHIKEHILLHILTHINDHINTHIREHISSHIVEHOBOHOCKHOFFHOLDHOLEHOLMHOLTHOMEHONEHONKHOODHOOFHOOKHOOTHORNHOSEHOSTHOURHOVEHOWEHOWLHOYTHUCKHUEDHUFFHUGEHUGHHUGOHULKHULLHUNKHUNTHURDHURLHURTHUSHHYDEHYMNIBISICONIDEAIDLEIFFYINCAINCHINTOIONSIOTAIOWAIRISIRMAIRONISLEITCHITEMIVANJACKJADEJAILJAKEJANEJAVAJEANJEFFJERKJESSJESTJIBEJILLJILTJIVEJOANJOBSJOCKJOELJOEYJOHNJOINJOKEJOLTJOVEJUDDJUDEJUDOJUDYJUJUJUKEJULYJUNEJUNKJUNOJURYJUSTJUTEKAHNKALEKANEKANTKARLKATEKEELKEENKENOKENTKERNKERRKEYSKICKKILLKINDKINGKIRKKISSKITEKLANKNEEKNEWKNITKNOBKNOTKNOWKOCHKONGKUDOKURDKURTKYLELACELACKLACYLADYLAIDLAINLAIRLAKELAMBLAMELANDLANELANGLARDLARKLASSLASTLATELAUDLAVALAWNLAWSLAYSLEADLEAFLEAKLEANLEARLEEKLEERLEFTLENDLENSLENTLEONLESKLESSLESTLETSLIARLICELICKLIEDLIENLIESLIEULIFELIFTLIKELILALILTLILYLIMALIMBLIMELINDLINELINKLINTLIONLISALISTLIVELOADLOAFLOAMLOANLOCKLOFTLOGELOISLOLALONELONGLOOKLOONLOOTLORDLORELOSELOSSLOSTLOUDLOVELOWELUCKLUCYLUGELUKELULULUNDLUNGLURALURELURKLUSHLUSTLYLELYNNLYONLYRAMACEMADEMAGIMAIDMAILMAINMAKEMALEMALIMALLMALTMANAMANNMANYMARCMAREMARKMARSMARTMARYMASHMASKMASSMASTMATEMATHMAULMAYOMEADMEALMEANMEATMEEKMEETMELDMELTMEMOMENDMENUMERTMESHMESSMICEMIKEMILDMILEMILKMILLMILTMIMIMINDMINEMINIMINKMINTMIREMISSMISTMITEMITTMOANMOATMOCKMODEMOLDMOLEMOLLMOLTMONAMONKMONTMOODMOONMOORMOOTMOREMORNMORTMOSSMOSTMOTHMOVEMUCHMUCKMUDDMUFFMULEMULLMURKMUSHMUSTMUTEMUTTMYRAMYTHNAGYNAILNAIRNAMENARYNASHNAVENAVYNEALNEARNEATNECKNEEDNEILNELLNEONNERONESSNESTNEWSNEWTNIBSNICENICKNILENINANINENOAHNODENOELNOLLNONENOOKNOONNORMNOSENOTENOUNNOVANUDENULLNUMBOATHOBEYOBOEODINOHIOOILYOINTOKAYOLAFOLDYOLGAOLINOMANOMENOMITONCEONESONLYONTOONUSORALORGYOSLOOTISOTTOOUCHOUSTOUTSOVALOVENOVEROWLYOWNSQUADQUITQUODRACERACKRACYRAFTRAGERAIDRAILRAINRAKERANKRANTRARERASHRATERAVERAYSREADREALREAMREARRECKREEDREEFREEKREELREIDREINRENARENDRENTRESTRICERICHRICKRIDERIFTRILLRIMERINGRINKRISERISKRITEROADROAMROARROBEROCKRODEROILROLLROMEROODROOFROOKROOMROOTROSAROSEROSSROSYROTHROUTROVEROWEROWSRUBERUBYRUDERUDYRUINRULERUNGRUNSRUNTRUSERUSHRUSKRUSSRUSTRUTHSACKSAFESAGESAIDSAILSALESALKSALTSAMESANDSANESANGSANKSARASAULSAVESAYSSCANSCARSCATSCOTSEALSEAMSEARSEATSEEDSEEKSEEMSEENSEESSELFSELLSENDSENTSETSSEWNSHAGSHAMSHAWSHAYSHEDSHIMSHINSHODSHOESHOTSHOWSHUNSHUTSICKSIDESIFTSIGHSIGNSILKSILLSILOSILTSINESINGSINKSIRESITESITSSITUSKATSKEWSKIDSKIMSKINSKITSLABSLAMSLATSLAYSLEDSLEWSLIDSLIMSLITSLOBSLOGSLOTSLOWSLUGSLUMSLURSMOGSMUGSNAGSNOBSNOWSNUBSNUGSOAKSOARSOCKSODASOFASOFTSOILSOLDSOMESONGSOONSOOTSORESORTSOULSOURSOWNSTABSTAGSTANSTARSTAYSTEMSTEWSTIRSTOWSTUBSTUNSUCHSUDSSUITSULKSUMSSUNGSUNKSURESURFSWABSWAGSWAMSWANSWATSWAYSWIMSWUMTACKTACTTAILTAKETALETALKTALLTANKTASKTATETAUTTEALTEAMTEARTECHTEEMTEENTEETTELLTENDTENTTERMTERNTESSTESTTHANTHATTHEETHEMTHENTHEYTHINTHISTHUDTHUGTICKTIDETIDYTIEDTIERTILETILLTILTTIMETINATINETINTTINYTIRETOADTOGOTOILTOLDTOLLTONETONGTONYTOOKTOOLTOOTTORETORNTOTETOURTOUTTOWNTRAGTRAMTRAYTREETREKTRIGTRIMTRIOTRODTROTTROYTRUETUBATUBETUCKTUFTTUNATUNETUNGTURFTURNTUSKTWIGTWINTWITULANUNITURGEUSEDUSERUSESUTAHVAILVAINVALEVARYVASEVASTVEALVEDAVEILVEINVENDVENTVERBVERYVETOVICEVIEWVINEVISEVOIDVOLTVOTEWACKWADEWAGEWAILWAITWAKEWALEWALKWALLWALTWANDWANEWANGWANTWARDWARMWARNWARTWASHWASTWATSWATTWAVEWAVYWAYSWEAKWEALWEANWEARWEEDWEEKWEIRWELDWELLWELTWENTWEREWERTWESTWHAMWHATWHEEWHENWHETWHOAWHOMWICKWIFEWILDWILLWINDWINEWINGWINKWINOWIREWISEWISHWITHWOLFWONTWOODWOOLWORDWOREWORKWORMWORNWOVEWRITWYNNYALEYANGYANKYARDYARNYAWLYAWNYEAHYEARYELLYOGAYOKE?*öLë#öLëöLëöŒìöLë öLëöLëöLëüõLëõõLëñõLëëõLëåõLëàõ íÛõ íÓõLëÌõLëÆõLëÃõLëÀõLëGöBöGö>ö3öGö>ö>ö>ö >ö Gö ,ö >ö >ö >ö>ö>ö3ö3ö3ödöYöTöLöƒscTABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/µtu®xu¨|ut©Ø1iø¨x.^H©x.S̨x.CÔ©x.;Ø©06ˆ©´0* ªœ-$t©x.H©x.ä©x.ªx.þô¨0øÌ©x.ìªx.â©è0ØÈ4Ð$©Ø1Çô©À2¼ø©0±ü©0¨ð©´0•© 2†(©Ø1|4©x.q,©Ø1g ©x.^|©´0YX©x.R5Dªx.<6.l©x.#d©´0x©´0€©´0`©´0øÔ¨x.í0©Ø1Ú © 2Ô©è0ÉШx.¿¬©À2³ªè0«©è0¥L©´0žL6˜T©x.Žü¨x.…ä¨x.}„©Ø1tȨl0e<©è0Vªx.K\©/DP©´0;Œ©´6/”©´0%©´0Ĩx.°©À2œ©x.è¨l0û,7óà©´0ì©Ø1ßà¨x.Ñè©x.Ä8©x.½¨©x.±ªè0¥È©x.–Ä©x.Œܨx.…©x.}˜©´3pЩx.jȨl0ap©x.Wt7OÀ¨x.J ©´3@¤©´3ÿÿÿÿ“#b‚#Ky#ck#ke#dX#ˆD#•9#Ž'#x#x#F #hý"Eï"Šè"mÝ"Î"“º"”«"–˜"œŽ"…‚"’v"‹f"p`"qT"¥J"rA"L3"‰&"s"S "H"„÷!Nï!vç!Và!AÒ!aÊ!—Å!B¸!›²!Cª! ¡!‘!Pˆ!D~!†v!eb!XR!ŒF!™A!g:!ƒ2!‡&!‚!!Gü Iñ ië là ¤Ó ¡Ð nÀ O´ o« £¥ Y˜  ‡ Q€ Rs ¢k Te tZ UR H YC w9 ˜d- Zô[ ] ^`-L_Ì_L`àeP¨.¤. .œ.6z6u6p6ç<Pà<ÿÿÿÿ‘>~>s>c>Q>XCÿÿÿÿÿÿÿÿGNU C crt1.sas: Sun WorkShop 6 99/08/16GNU C crti.sas: Sun WorkShop 6 99/08/16@(#)SunOS 5.8 Generic February 2000GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GCC: (GNU) 2.95.2 19991024 (release)as: Sun WorkShop 6 99/08/16GNU C crtn.oas: Sun WorkShop 6 99/08/16ld: Solaris Link Editors: 5.8-1.272.interp.hash.dynsym.dynstr.SUNW_version.rel.got.rel.bss.rel.plt.plt.text.init.fini.rodata.got.dynamic.data.ctors.dtors.eh_frame.bss.symtab.strtab.comment.stab.index.stab.shstrtab.stab.indexstr.stabstrÔÔ èè  ð ð ð"à!à!ÝþÿÿoÀ2À2€- B@3@36 BX3X3 ? Bx3x3` HØ6Ø6ÐM¨=¨=r–S Ô Ô#YPÔPÔ_€Ô€ÔÞp g`E`EÈl(G(GÐuHH¨, {¨t¨t‚°t°t‰¸t¸t“ÀtÀt89 ¨¼t§ à c~å0707010020a35a000041ed000027130000271000000004502b7c6500000000000000c300000fc500000000000000000000001300000000root/opt/csw/share0707010020a35f000041ed000027130000271000000003502b7c6500000000000000c300000fc500000000000000000000001700000000root/opt/csw/share/man0707010020a360000041ed000027130000271000000002502b7c6500000000000000c300000fc500000000000000000000001c00000000root/opt/csw/share/man/man10707010020a361000081a4000027130000271000000001502b7c5e00004b1c000000c300000fc500000000000000000000002600000000root/opt/csw/share/man/man1/pkgutil.1.\" Automatically generated by Pod::Man 2.22 (Pod::Simple 3.15) .\" .\" Standard preamble: .\" ======================================================================== .de Sp \" Vertical space (when we can't use .PP) .if t .sp .5v .if n .sp .. .de Vb \" Begin verbatim text .ft CW .nf .ne \\$1 .. .de Ve \" End verbatim text .ft R .fi .. .\" Set up some character translations and predefined strings. \*(-- will .\" give an unbreakable dash, \*(PI will give pi, \*(L" will give a left .\" double quote, and \*(R" will give a right double quote. \*(C+ will .\" give a nicer C++. Capital omega is used to do unbreakable dashes and .\" therefore won't be available. \*(C` and \*(C' expand to `' in nroff, .\" nothing in troff, for use with C<>. .tr \(*W- .ds C+ C\v'-.1v'\h'-1p'\s-2+\h'-1p'+\s0\v'.1v'\h'-1p' .ie n \{\ . ds -- \(*W- . ds PI pi . if (\n(.H=4u)&(1m=24u) .ds -- \(*W\h'-12u'\(*W\h'-12u'-\" diablo 10 pitch . if (\n(.H=4u)&(1m=20u) .ds -- \(*W\h'-12u'\(*W\h'-8u'-\" diablo 12 pitch . ds L" "" . ds R" "" . ds C` "" . ds C' "" 'br\} .el\{\ . ds -- \|\(em\| . ds PI \(*p . ds L" `` . ds R" '' 'br\} .\" .\" Escape single quotes in literal strings from groff's Unicode transform. .ie \n(.g .ds Aq \(aq .el .ds Aq ' .\" .\" If the F register is turned on, we'll generate index entries on stderr for .\" titles (.TH), headers (.SH), subsections (.SS), items (.Ip), and index .\" entries marked with X<> in POD. Of course, you'll have to process the .\" output yourself in some meaningful fashion. .ie \nF \{\ . de IX . tm Index:\\$1\t\\n%\t"\\$2" .. . nr % 0 . rr F .\} .el \{\ . de IX .. .\} .\" .\" Accent mark definitions (@(#)ms.acc 1.5 88/02/08 SMI; from UCB 4.2). .\" Fear. Run. Save yourself. No user-serviceable parts. . \" fudge factors for nroff and troff .if n \{\ . ds #H 0 . ds #V .8m . ds #F .3m . ds #[ \f1 . ds #] \fP .\} .if t \{\ . ds #H ((1u-(\\\\n(.fu%2u))*.13m) . ds #V .6m . ds #F 0 . ds #[ \& . ds #] \& .\} . \" simple accents for nroff and troff .if n \{\ . ds ' \& . ds ` \& . ds ^ \& . ds , \& . ds ~ ~ . ds / .\} .if t \{\ . ds ' \\k:\h'-(\\n(.wu*8/10-\*(#H)'\'\h"|\\n:u" . ds ` \\k:\h'-(\\n(.wu*8/10-\*(#H)'\`\h'|\\n:u' . ds ^ \\k:\h'-(\\n(.wu*10/11-\*(#H)'^\h'|\\n:u' . ds , \\k:\h'-(\\n(.wu*8/10)',\h'|\\n:u' . ds ~ \\k:\h'-(\\n(.wu-\*(#H-.1m)'~\h'|\\n:u' . ds / \\k:\h'-(\\n(.wu*8/10-\*(#H)'\z\(sl\h'|\\n:u' .\} . \" troff and (daisy-wheel) nroff accents .ds : \\k:\h'-(\\n(.wu*8/10-\*(#H+.1m+\*(#F)'\v'-\*(#V'\z.\h'.2m+\*(#F'.\h'|\\n:u'\v'\*(#V' .ds 8 \h'\*(#H'\(*b\h'-\*(#H' .ds o \\k:\h'-(\\n(.wu+\w'\(de'u-\*(#H)/2u'\v'-.3n'\*(#[\z\(de\v'.3n'\h'|\\n:u'\*(#] .ds d- \h'\*(#H'\(pd\h'-\w'~'u'\v'-.25m'\f2\(hy\fP\v'.25m'\h'-\*(#H' .ds D- D\\k:\h'-\w'D'u'\v'-.11m'\z\(hy\v'.11m'\h'|\\n:u' .ds th \*(#[\v'.3m'\s+1I\s-1\v'-.3m'\h'-(\w'I'u*2/3)'\s-1o\s+1\*(#] .ds Th \*(#[\s+2I\s-2\h'-\w'I'u*3/5'\v'-.3m'o\v'.3m'\*(#] .ds ae a\h'-(\w'a'u*4/10)'e .ds Ae A\h'-(\w'A'u*4/10)'E . \" corrections for vroff .if v .ds ~ \\k:\h'-(\\n(.wu*9/10-\*(#H)'\s-2\u~\d\s+2\h'|\\n:u' .if v .ds ^ \\k:\h'-(\\n(.wu*10/11-\*(#H)'\v'-.4m'^\v'.4m'\h'|\\n:u' . \" for low resolution devices (crt and lpr) .if \n(.H>23 .if \n(.V>19 \ \{\ . ds : e . ds 8 ss . ds o a . ds d- d\h'-1'\(ga . ds D- D\h'-1'\(hy . ds th \o'bp' . ds Th \o'LP' . ds ae ae . ds Ae AE .\} .rm #[ #] #H #V #F C .\" ======================================================================== .\" .IX Title "PKGUTIL 1" .TH PKGUTIL 1 "2012-08-15" "perl v5.10.1" "User Contributed Perl Documentation" .\" For nroff, turn off justification. Always turn off hyphenation; it makes .\" way too many mistakes in technical documents. .if n .ad l .nh .SH "NAME" pkgutil \- install Solaris packages the easy way .SH "SYNOPSIS" .IX Header "SYNOPSIS" pkgutil [option]... [package]... .SH "DESCRIPTION" .IX Header "DESCRIPTION" Pkgutil, written in Perl and licensed under \s-1GPL\s0, is a tool to make installation of packages in Solaris easier. .PP It handles package dependencies so all required packages are installed before the desired package automatically. .PP A catalog is used to make this possible. The format is: .PP common_name\ version\ package_name\ file_name\ md5_hash\ pkg_size\ dependencies\ category .PP Example: .PP bind\ 9.4.2,REV=2008.07.09_rev=p1\ CSWbind\ bind\-9.4.2,REV=2008.07.09_rev=p1\-SunOS5.8\-sparc\-CSW.pkg.gz\ f68df57fcf54bfd37304b79d6f7eeacc\ 2954112\ CSWcommon|CSWosslrt\ net .PP In the example CSWbind has two dependencies separated by a pipe. Multiple categories can also be separated by pipe characters. .SH "OPTIONS" .IX Header "OPTIONS" .IP "\fB\-i, \-\-install\fR" 5 .IX Item "-i, --install" Install package. Will install the specified packages with all their dependencies. You may specify an explicit version (e.g. amarok\-1.4.8,REV=2008.02.26) if desired, otherwise the latest version found is chosen. .IP "\fB\-u, \-\-upgrade\fR" 5 .IX Item "-u, --upgrade" Upgrade package. A special argument is \*(L"all\*(R" which will upgrade all installed packages if possible, no argument is the same as \*(L"all\*(R". If one or more packages are given as arguments only those will be upgraded. .IP "\fB\-r, \-\-remove\fR" 5 .IX Item "-r, --remove" Remove package. This will remove a package including all dependencies that are not in use by other packages. .Sp Note that this feature is experimental. Use with caution. .IP "\fB\-d, \-\-download\fR" 5 .IX Item "-d, --download" Download only. Same as install but stops after downloading the packages. .IP "\fB\-U, \-\-catalog\fR" 5 .IX Item "-U, --catalog" Update catalog. .IP "\fB\-a, \-\-available\fR" 5 .IX Item "-a, --available" Show available packages. .IP "\fB\-\-describe\fR" 5 .IX Item "--describe" Describe available packages. .IP "\fB\-c, \-\-compare\fR" 5 .IX Item "-c, --compare" Compare installed packages to current. .IP "\fB\-C, \-\-compare\-diff\fR" 5 .IX Item "-C, --compare-diff" Compare installed packages to current, show only different versions. .IP "\fB\-A, \-\-compare\-avail\fR" 5 .IX Item "-A, --compare-avail" Compare available packages to those installed. .IP "\fB\-e, \-\-email=address\fR" 5 .IX Item "-e, --email=address" Send e\-mail with available updates. E\-mail address as argument. Don't use with other options. .IP "\fB\-t, \-\-temp=site\fR" 5 .IX Item "-t, --temp=site" Temporarily use this site for download. Must be the complete url where to find the catalog and associated packages. May be specified multiple times. .IP "\fB\-s, \-\-stream\fR" 5 .IX Item "-s, --stream" Build a package stream for a certain architecture and \s-1OS\s0 release. All dependencies will be included in the stream and the needed command to install them in the correct order will be displayed. Must be used with \-d. .IP "\fB\-T, \-\-target=arch:rel\fR" 5 .IX Item "-T, --target=arch:rel" Specify architecture and \s-1OS\s0 release when downloading, e.g. i386:5.9 or sparc:5.10. If not specified defaults to architecture and release of the host running pkgutil. .IP "\fB\-o, \-\-output=file\fR" 5 .IX Item "-o, --output=file" File name for package stream. Used with \-s. A special argument is \*(L"\-\*(R" which sends the stream to standard output, see example below. The default name is the first package argument followed by architecture and \s-1OS\s0 release, for example \*(L"bind.i386.5.10.pkg\*(R". .IP "\fB\-x, \-\-exclude=pattern\fR" 5 .IX Item "-x, --exclude=pattern" Simple pattern that will exclude matching packages. This option can be specified multiple times. .IP "\fB\-W, \-\-workdir=path\fR" 5 .IX Item "-W, --workdir=path" Path to use for work directory. This can be used to run pkgutil as non-root, e.g. called from a web server. .IP "\fB\-P, \-\-pkgdir=path\fR" 5 .IX Item "-P, --pkgdir=path" Path to use for package downloads. This can be used to run pkgutil as non-root, e.g. called from a web server. Default is /package. .IP "\fB\-R, \-\-rootpath=path\fR" 5 .IX Item "-R, --rootpath=path" Path to use for root_path. This is used by Solaris pkg tools like pkgadd, pkgrm and so on. Setting this option overrides root_path in pkgutil.conf. Default is not set. .IP "\fB\-\-config=file\fR" 5 .IX Item "--config=file" Use this configuration file instead of the default ones. .IP "\fB\-y, \-\-yes\fR" 5 .IX Item "-y, --yes" Answer yes on all prompts. Skips prompt when multiple packares are to be downloaded. Makes pkgrm/pkgadd operations more silent and without prompts. Only makes sense with \-i and \-u. .IP "\fB\-f, \-\-force\fR" 5 .IX Item "-f, --force" Force updates regardless of version compare result, as long as local and mirror version is not the same an update is carried out. This can be used as a rollback from the testing mirror to current or from current to stable for example. .IP "\fB\-n, \-\-nomod\fR" 5 .IX Item "-n, --nomod" No modifications are made to the system. Stops before downloading catalog/packages. Use it to simulate if catalog needs updating or which packages will be downloaded. Only makes sense with \-i, \-u and \-U. .IP "\fB\-N, \-\-nodeps\fR" 5 .IX Item "-N, --nodeps" No dependencies, only what you specify on the command line will be used. Useful when using pkgutil as a download tool of specific packages or if you use the testing repo that might pull in unwanted packages. .IP "\fB\-D, \-\-debug\fR" 5 .IX Item "-D, --debug" Debug mode. Adds a lot of info about what's going on. Only use if you're having problems you think is a bug. .IP "\fB\-\-trace\fR" 5 .IX Item "--trace" Set trace mode (\-v) for pkgadd/pkgrm. .IP "\fB\-h, \-\-help\fR" 5 .IX Item "-h, --help" Show this help. .IP "\fB\-v, \-\-version\fR" 5 .IX Item "-v, --version" Show pkgutil version. .IP "\fB\-V, \-\-syscheck\fR" 5 .IX Item "-V, --syscheck" System check. This shows info about binaries and more that pkgutil needs to support all features. .IP "\fB\-l, \-\-list\fR" 5 .IX Item "-l, --list" List installed packages. .IP "\fB\-L, \-\-listfile\fR" 5 .IX Item "-L, --listfile" List files in packages. Works on both installed packages as well as on (uncompressed) package files. You can even mix them on the command line. .IP "\fB\-F, \-\-findfile\fR" 5 .IX Item "-F, --findfile" Find files in installed packages. .IP "\fB\-\-deptree=depth\fR" 5 .IX Item "--deptree=depth" Display dependency tree. Depth is the number of levels to show, minumum is 1. .IP "\fB\-\-extract\fR" 5 .IX Item "--extract" Will fetch and extract package content. Must be used with \-d. .IP "\fB\-\-single\fR" 5 .IX Item "--single" Single package check. This is much faster than checking all installed packages, note that using something like \*(L"\-c foo\*(R" still checks all packages, it just filters the output to only show lines containing foo. Must be used with \-c. .IP "\fB\-p, \-\-param=opt:val\fR" 5 .IX Item "-p, --param=opt:val" Override configuration option. All configuration options in pkgutil.conf can be overridden except the mirror option (use \-t for that). This can be useful if you temporarily want to disable gpg checks for example. .IP "\fB\-\-parse\fR" 5 .IX Item "--parse" Machine parsable output, no headers and all columns are separated by one tab. Use this together with scripts to get a reliable output format that is simpler to parse. .IP "\fB\-\-cleanup\fR" 5 .IX Item "--cleanup" Clean up obsolete packages. For example a renamed package that is not needed any more. .IP "\fB\-\-catinfo\fR" 5 .IX Item "--catinfo" Display information about the catalogs used, e.g. number of packages and local path. .SH "EXAMPLES" .IX Header "EXAMPLES" .SS "Example 1" .IX Subsection "Example 1" \&\f(CW\*(C`# pkgutil \-i CSWbind\*(C'\fR .PP Will install CSWbind with all required dependencies. .SS "Example 2" .IX Subsection "Example 2" \&\f(CW\*(C`# pkgutil \-e nobody@foo.bar\*(C'\fR .PP Will run silently and send an e\-mail (with mailx) to the given address if there's updated packages available. Run it from crontab once weekly. .SS "Example 3" .IX Subsection "Example 3" \&\f(CW\*(C`# pkgutil \-y \-o \- \-s bind | gzip > bind.pkg.gz\*(C'\fR .PP Will send a package stream including all dependencies needed for CSWbind to standard output which is piped to gzip. With \*(L"\-o \-\*(R" the normal output is sent to standard error and \*(L"\-y\*(R" is used to skip the confirmation prompt. .SS "Example 4" .IX Subsection "Example 4" \&\f(CW\*(C`# pkgutil \-T i386:5.10 \-s bind\*(C'\fR .PP Will make a package stream including all dependencies needed for CSWbind. The package stream will contain packages for the i386 architecture and Solaris 10 regardless of host used to run pkgutil. .SH "CONFIGURATION" .IX Header "CONFIGURATION" Pkgutil uses a configuration file, pkgutil.conf, that contains a few important settings. No modifications are mandatory though since pkgutil will happily run with the defaults. .PP There's a configuration file in /opt/csw/etc/pkgutil.conf. The only thing you normally need to change there is the mirror location. If you have a pkgutil.conf file in /etc/opt/csw it will override the one in /opt/csw/etc on a setting-by-setting basis. If no pkgutil.conf is found in either of those two locations defaults are used. .PP The settings that can be used are: .PP \&\f(CW\*(C`catalog_not_cached\*(C'\fR .PP Tells your proxy server to disable caching during fetching of the catalog and descriptions. Default is true. .PP \&\f(CW\*(C`catalog_update\*(C'\fR .PP Number of days between automatic catalog updates. Special cases are \-1 if you want to disable automatic updates and 0 if you always want to update the catalog. Default is 14. .PP \&\f(CW\*(C`deptree_filter_common\*(C'\fR .PP Filter out CSWcommon from \-\-deptree output. Useful since almost every package depends on CSWcommon, setting this option to true reduces the number of lines a lot without affecting the actual information much. Default is false. .PP \&\f(CW\*(C`exclude_pattern\*(C'\fR .PP Space separated list of simple patterns that will exclude matching packages when updating or installing. If you, e.g., never want cups related packages updated accidentally you can add the string cups here, this will exclude all package names that contain that string. Default is blank. .PP \&\f(CW\*(C`gpg_homedir\*(C'\fR .PP The path to the gpg directory (instead of ~/.gnupg or /var/opt/csw/pkgi if CSWpki is installed) when verifying the catalogs integrity. .PP \&\f(CW\*(C`maxpkglist\*(C'\fR .PP During dependency calculation the recursive algorithm needs to be protected against cyclic dependencies in the catalog (packages that list each other as dependencies) or pkgutil will not stop until memory is exhausted. This sets the maximum number of recursions before pkgutil stops. .PP \&\f(CW\*(C`mirror\*(C'\fR .PP This is the mirror that is used for downloading the catalog and packages. Try setting it to your nearest mirror to improve download speed. This option may be specified multiple times. .PP It also supports (in an experimental way) the file:// protocol for local/NFS mirrors. Example: \f(CW\*(C`mirror=file:///absolute/path/to/files\*(C'\fR .PP \&\f(CW\*(C`noncsw\*(C'\fR .PP Enable (default is disable) support for non-CSW prefixed packages. .PP Pkgutil also uses a file to configure pkgadd when the yes (\-y) option is used. This file is located in /var/opt/csw/pkgutil and is called admin. It's by default set up to fully automate installations but if you change something in this file it will be preserved during upgrades of pkgutil. Read more about the admin file with \*(L"man \-s4 admin\*(R". .PP \&\f(CW\*(C`pkgaddopts\*(C'\fR .PP Send options to pkgadd, one example is \-G that will only install the packages in the global zone for Solaris 10. A useful setting is \-S, that will not display the license during install. .PP \&\f(CW\*(C`pkgliststyle\*(C'\fR .PP Style of package list when installing/upgrading packages. 0 is the one used since the first version of pkgutil, it's space efficient but less readable. 1 is the one introduced in v1.7, it's one package per line which is easier to read. 2 is the same as 1 but also displays which distribution a package comes from, e.g. unstable or stable. .PP \&\f(CW\*(C`pkgrmopts\*(C'\fR .PP Send options to pkgrm, one example is \*(L"\-O nozones\*(R" that will only deinstall the packages in the global zone for Solaris 10. .PP \&\f(CW\*(C`root_path\*(C'\fR .PP Set alternate root path (\-R with pkg commands). Default is /. .PP \&\f(CW\*(C`show_current\*(C'\fR .PP Show the current list of packages or not. You can choose to not show the list of current packages to get less output when doing operations. Default is true. .PP \&\f(CW\*(C`stop_on_hook_soft_error\*(C'\fR .PP This option determines whether or not execution will be halted if a hook returns 2 as its exit code. Execution is always stopped if a hook returns 1. Set this to true to enable it. .PP \&\f(CW\*(C`use_gpg\*(C'\fR \&\f(CW\*(C`use_md5\*(C'\fR .PP These two can enable (default is disabled for both) checking the catalogs integrity (\s-1GPG\s0) and that each downloaded file is unchanged from the published one (\s-1MD5\s0). To use \s-1GPG\s0 you need CSWgnupg installed. \s-1MD5\s0 is supported by default in Solaris 10 and on Solaris 8 and 9 if you have CSWperl installed and have /opt/csw/bin first in your path. You can also install CSWcoreutils to get \s-1MD5\s0 support. .PP \&\f(CW\*(C`wgetopts\*(C'\fR .PP Send options to wget, for example to show more or less information during downloads. .SH "PKGASK RESPONSE FILES" .IX Header "PKGASK RESPONSE FILES" Pkgutil supports pkgask response files and will use them if you provide them. Create a pkgask directory in your work directory (normally /var/opt/csw/pkgutil) and put your response files there. .SH "SEE ALSO" .IX Header "SEE ALSO" http://pkgutil.net .PP http://sourceforge.net/projects/pkgutil .SH "TODO" .IX Header "TODO" Add unit testing. .SH "AUTHOR" .IX Header "AUTHOR" Peter Bonivart .SH "CREDITS" .IX Header "CREDITS" Mark Bannister .PP Joe Baro .PP Maciej Blizinski .PP Dennis Clarke .PP Ihsan Dogan .PP David Everly .PP Neil Houston .PP Don Jackson .PP Sebastian Kayser .PP Trygve Laugstol .PP James Lee .PP Juraj Lutter .PP Dagobert Michelsen .PP Yann Rouillard .PP Remko de Vrijer .PP Ben Walton .PP Derek Whayman .PP For more details, see the readme file. .SH "COPYRIGHT AND DISCLAIMER" .IX Header "COPYRIGHT AND DISCLAIMER" Copyright (C) 2008\-2012 Peter Bonivart. This program is free software; you can redistribute it and/or modify it under the terms of the \s-1GNU\s0 General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. .PP This program is distributed in the hope that it will be useful, but \s-1WITHOUT\s0 \s-1ANY\s0 \s-1WARRANTY\s0; without even the implied warranty of \s-1MERCHANTABILITY\s0 or \s-1FITNESS\s0 \s-1FOR\s0 A \s-1PARTICULAR\s0 \s-1PURPOSE\s0. See the \s-1GNU\s0 General Public License for more details. .PP You should have received a copy of the \s-1GNU\s0 General Public License along with this program; if not, write to the Free Software Foundation, Inc., 59 Temple Place, Suite 330, Boston, \s-1MA\s0 02111\-1307 \s-1USA\s0. 0707010020a35b000041ed000027130000271000000003502b7c6500000000000000c300000fc500000000000000000000001700000000root/opt/csw/share/doc0707010020a35c000041ed000027130000271000000002502b7c6500000000000000c300000fc500000000000000000000001f00000000root/opt/csw/share/doc/pkgutil0707010020a35d000081a4000027130000271000000001502b7c5f00004657000000c300000fc500000000000000000000002700000000root/opt/csw/share/doc/pkgutil/license GNU GENERAL PUBLIC LICENSE Version 2, June 1991 Copyright (C) 1989, 1991 Free Software Foundation, Inc. 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. Preamble The licenses for most software are designed to take away your freedom to share and change it. By contrast, the GNU General Public License is intended to guarantee your freedom to share and change free software--to make sure the software is free for all its users. This General Public License applies to most of the Free Software Foundation's software and to any other program whose authors commit to using it. (Some other Free Software Foundation software is covered by the GNU Library General Public License instead.) You can apply it to your programs, too. When we speak of free software, we are referring to freedom, not price. Our General Public Licenses are designed to make sure that you have the freedom to distribute copies of free software (and charge for this service if you wish), that you receive source code or can get it if you want it, that you can change the software or use pieces of it in new free programs; and that you know you can do these things. To protect your rights, we need to make restrictions that forbid anyone to deny you these rights or to ask you to surrender the rights. These restrictions translate to certain responsibilities for you if you distribute copies of the software, or if you modify it. For example, if you distribute copies of such a program, whether gratis or for a fee, you must give the recipients all the rights that you have. You must make sure that they, too, receive or can get the source code. And you must show them these terms so they know their rights. We protect your rights with two steps: (1) copyright the software, and (2) offer you this license which gives you legal permission to copy, distribute and/or modify the software. Also, for each author's protection and ours, we want to make certain that everyone understands that there is no warranty for this free software. If the software is modified by someone else and passed on, we want its recipients to know that what they have is not the original, so that any problems introduced by others will not reflect on the original authors' reputations. Finally, any free program is threatened constantly by software patents. We wish to avoid the danger that redistributors of a free program will individually obtain patent licenses, in effect making the program proprietary. To prevent this, we have made it clear that any patent must be licensed for everyone's free use or not licensed at all. The precise terms and conditions for copying, distribution and modification follow. GNU GENERAL PUBLIC LICENSE TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION 0. This License applies to any program or other work which contains a notice placed by the copyright holder saying it may be distributed under the terms of this General Public License. The "Program", below, refers to any such program or work, and a "work based on the Program" means either the Program or any derivative work under copyright law: that is to say, a work containing the Program or a portion of it, either verbatim or with modifications and/or translated into another language. (Hereinafter, translation is included without limitation in the term "modification".) Each licensee is addressed as "you". Activities other than copying, distribution and modification are not covered by this License; they are outside its scope. The act of running the Program is not restricted, and the output from the Program is covered only if its contents constitute a work based on the Program (independent of having been made by running the Program). Whether that is true depends on what the Program does. 1. You may copy and distribute verbatim copies of the Program's source code as you receive it, in any medium, provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice and disclaimer of warranty; keep intact all the notices that refer to this License and to the absence of any warranty; and give any other recipients of the Program a copy of this License along with the Program. You may charge a fee for the physical act of transferring a copy, and you may at your option offer warranty protection in exchange for a fee. 2. You may modify your copy or copies of the Program or any portion of it, thus forming a work based on the Program, and copy and distribute such modifications or work under the terms of Section 1 above, provided that you also meet all of these conditions: a) You must cause the modified files to carry prominent notices stating that you changed the files and the date of any change. b) You must cause any work that you distribute or publish, that in whole or in part contains or is derived from the Program or any part thereof, to be licensed as a whole at no charge to all third parties under the terms of this License. c) If the modified program normally reads commands interactively when run, you must cause it, when started running for such interactive use in the most ordinary way, to print or display an announcement including an appropriate copyright notice and a notice that there is no warranty (or else, saying that you provide a warranty) and that users may redistribute the program under these conditions, and telling the user how to view a copy of this License. (Exception: if the Program itself is interactive but does not normally print such an announcement, your work based on the Program is not required to print an announcement.) These requirements apply to the modified work as a whole. If identifiable sections of that work are not derived from the Program, and can be reasonably considered independent and separate works in themselves, then this License, and its terms, do not apply to those sections when you distribute them as separate works. But when you distribute the same sections as part of a whole which is a work based on the Program, the distribution of the whole must be on the terms of this License, whose permissions for other licensees extend to the entire whole, and thus to each and every part regardless of who wrote it. Thus, it is not the intent of this section to claim rights or contest your rights to work written entirely by you; rather, the intent is to exercise the right to control the distribution of derivative or collective works based on the Program. In addition, mere aggregation of another work not based on the Program with the Program (or with a work based on the Program) on a volume of a storage or distribution medium does not bring the other work under the scope of this License. 3. You may copy and distribute the Program (or a work based on it, under Section 2) in object code or executable form under the terms of Sections 1 and 2 above provided that you also do one of the following: a) Accompany it with the complete corresponding machine-readable source code, which must be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange; or, b) Accompany it with a written offer, valid for at least three years, to give any third party, for a charge no more than your cost of physically performing source distribution, a complete machine-readable copy of the corresponding source code, to be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange; or, c) Accompany it with the information you received as to the offer to distribute corresponding source code. (This alternative is allowed only for noncommercial distribution and only if you received the program in object code or executable form with such an offer, in accord with Subsection b above.) The source code for a work means the preferred form of the work for making modifications to it. For an executable work, complete source code means all the source code for all modules it contains, plus any associated interface definition files, plus the scripts used to control compilation and installation of the executable. However, as a special exception, the source code distributed need not include anything that is normally distributed (in either source or binary form) with the major components (compiler, kernel, and so on) of the operating system on which the executable runs, unless that component itself accompanies the executable. If distribution of executable or object code is made by offering access to copy from a designated place, then offering equivalent access to copy the source code from the same place counts as distribution of the source code, even though third parties are not compelled to copy the source along with the object code. 4. You may not copy, modify, sublicense, or distribute the Program except as expressly provided under this License. Any attempt otherwise to copy, modify, sublicense or distribute the Program is void, and will automatically terminate your rights under this License. However, parties who have received copies, or rights, from you under this License will not have their licenses terminated so long as such parties remain in full compliance. 5. You are not required to accept this License, since you have not signed it. However, nothing else grants you permission to modify or distribute the Program or its derivative works. These actions are prohibited by law if you do not accept this License. Therefore, by modifying or distributing the Program (or any work based on the Program), you indicate your acceptance of this License to do so, and all its terms and conditions for copying, distributing or modifying the Program or works based on it. 6. Each time you redistribute the Program (or any work based on the Program), the recipient automatically receives a license from the original licensor to copy, distribute or modify the Program subject to these terms and conditions. You may not impose any further restrictions on the recipients' exercise of the rights granted herein. You are not responsible for enforcing compliance by third parties to this License. 7. If, as a consequence of a court judgment or allegation of patent infringement or for any other reason (not limited to patent issues), conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the conditions of this License, they do not excuse you from the conditions of this License. If you cannot distribute so as to satisfy simultaneously your obligations under this License and any other pertinent obligations, then as a consequence you may not distribute the Program at all. For example, if a patent license would not permit royalty-free redistribution of the Program by all those who receive copies directly or indirectly through you, then the only way you could satisfy both it and this License would be to refrain entirely from distribution of the Program. If any portion of this section is held invalid or unenforceable under any particular circumstance, the balance of the section is intended to apply and the section as a whole is intended to apply in other circumstances. It is not the purpose of this section to induce you to infringe any patents or other property right claims or to contest validity of any such claims; this section has the sole purpose of protecting the integrity of the free software distribution system, which is implemented by public license practices. Many people have made generous contributions to the wide range of software distributed through that system in reliance on consistent application of that system; it is up to the author/donor to decide if he or she is willing to distribute software through any other system and a licensee cannot impose that choice. This section is intended to make thoroughly clear what is believed to be a consequence of the rest of this License. 8. If the distribution and/or use of the Program is restricted in certain countries either by patents or by copyrighted interfaces, the original copyright holder who places the Program under this License may add an explicit geographical distribution limitation excluding those countries, so that distribution is permitted only in or among countries not thus excluded. In such case, this License incorporates the limitation as if written in the body of this License. 9. The Free Software Foundation may publish revised and/or new versions of the General Public License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. Each version is given a distinguishing version number. If the Program specifies a version number of this License which applies to it and "any later version", you have the option of following the terms and conditions either of that version or of any later version published by the Free Software Foundation. If the Program does not specify a version number of this License, you may choose any version ever published by the Free Software Foundation. 10. If you wish to incorporate parts of the Program into other free programs whose distribution conditions are different, write to the author to ask for permission. For software which is copyrighted by the Free Software Foundation, write to the Free Software Foundation; we sometimes make exceptions for this. Our decision will be guided by the two goals of preserving the free status of all derivatives of our free software and of promoting the sharing and reuse of software generally. NO WARRANTY 11. BECAUSE THE PROGRAM IS LICENSED FREE OF CHARGE, THERE IS NO WARRANTY FOR THE PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU. SHOULD THE PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION. 12. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR REDISTRIBUTE THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. END OF TERMS AND CONDITIONS How to Apply These Terms to Your New Programs If you develop a new program, and you want it to be of the greatest possible use to the public, the best way to achieve this is to make it free software which everyone can redistribute and change under these terms. To do so, attach the following notices to the program. It is safest to attach them to the start of each source file to most effectively convey the exclusion of warranty; and each file should have at least the "copyright" line and a pointer to where the full notice is found. Copyright (C) 19yy This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA Also add information on how to contact you by electronic and paper mail. If the program is interactive, make it output a short notice like this when it starts in an interactive mode: Gnomovision version 69, Copyright (C) 19yy name of author Gnomovision comes with ABSOLUTELY NO WARRANTY; for details type `show w'. This is free software, and you are welcome to redistribute it under certain conditions; type `show c' for details. The hypothetical commands `show w' and `show c' should show the appropriate parts of the General Public License. Of course, the commands you use may be called something other than `show w' and `show c'; they could even be mouse-clicks or menu items--whatever suits your program. You should also get your employer (if you work as a programmer) or your school, if any, to sign a "copyright disclaimer" for the program, if necessary. Here is a sample; alter the names: Yoyodyne, Inc., hereby disclaims all copyright interest in the program `Gnomovision' (which makes passes at compilers) written by James Hacker. , 1 April 1989 Ty Coon, President of Vice This General Public License does not permit incorporating your program into proprietary programs. If your program is a subroutine library, you may consider it more useful to permit linking proprietary applications with the library. If this is what you want to do, use the GNU Library General Public License instead of this License. 0707010020a35e000081a4000027130000271000000001502b7c5e00004d10000000c300000fc500000000000000000000002600000000root/opt/csw/share/doc/pkgutil/readmePKGUTIL ======= Pkgutil, written in Perl and licensed under GPL, is a tool to make installation of packages in Solaris easier. It handles package dependencies so all required packages are installed before the desired package automatically. Configure --------- There's a configuration file in /opt/csw/etc/pkgutil.conf. The only thing you normally need to change there is the mirror location. If you have a pkgutil.conf file in /etc/opt/csw it will override the one in /opt/csw/etc on a setting-by-setting basis. If no pkgutil.conf is found in either of those two locations defaults are used. Official web sites ------------------ URL: http://pkgutil.net URL: http://sourceforge.net/projects/pkgutil Version history --------------- * v2.6.5. Released 2012-08-15 - Fix bug in sparse zone detection, should not trigger when only downloading (Dagobert Michelsen) * v2.6.4. Released 2012-02-21 - Fix bug in --cleanup (Laurent Blume) * v2.6.3. Released 2012-02-17 - Fix bug with using pkgcond on old Solaris versions (mikera) * v2.6.2. Released 2012-02-04 - Make wget quiet (Dago) - Fix bug in old (Perl 5.5.3 in Solaris 8) Getopt::Long not handling default values for --deptree (Raboo@IRC) - Recommend CSWcswpki in pkgutil.conf * v2.6.1. Released 2012-01-13 - Flush pkgserv cache before using /var/sadm/install/contents (Dago) - chkcat: algorithm for cyclic dependency checking improved, it's now so fast that option --nocyclic is deprecated (Dago) * v2.6. Released 2011-12-31 - Support site feature RELEASE. Cache names locally, if changed (testing starts to point to kiel instead of dublin e.g.) an alert is issued - Add --catinfo option, OpenCSW #4835 (Sebastian Kayser) - Warn about cswclassutils not in global zone when running in sparse zone (detect read-only /usr) - Change default mirror to http://mirror.opencsw.org/opencsw/testing - Add /usr/perl5/bin to PATH (Dago) - Default unlimited depth for --deptree (Sebastian) - Use -q as default for wget (Dago) - Document (on wiki) how to use pkgutil on Linux for downloading - Add /usr/bin path to locate wget to ease running on Linux - Fix typo in readme about rootpath option - bldcat: make --param very generic, every unrecognized foo:bar means it will be inserted into the catalog as a magic comment (# foo bar) - bldcat: add param option including timestamp and release name * v2.5.1. Released 2011-09-11 - Fix bug with how gpg is called (Ben Walton) * v2.5. Released 2011-09-06 - Package is now for Solaris 9 (code still runs on Solaris 8) - Package is now arch=all - pkgutil, bldcat and chkcat run through perlcritic and perltidy - Exit codes in pkgutil cleaned up. Use 0 for anything less than an error - pkgutil resets LD_LIBRARY_PATH (Dago) - Untaint: clear ENV variables, set PATH, almost all system calls split up - Reverse order of current, updated and new packages (Ben Walton) - Add option -R/--rootpath for consistency with Solaris pkg tools. Can be used with LU (Dago) - Add levels to --deptree - Add package dir option (-P/--pkgdir) so doesn't have to be /package (Mark Phillips) - Add note about multiple mirrors in pkgutil.conf - Add pkgrmopts in pkgutil.conf for specifying pkgrm options (Juraj Lutter) - Fix bug with "-o -" for streams (Dago) - bldcat: ignore i-deps when version specified in depend file (Dominic Cleal) - bldcat: change default work dir from /tmp to /var/tmp since it's safer (Mark Phillips) - chkcat: add --parse option * v2.4. Released 2011-05-15 - pkgutil: new option --cleanup. When invoked, scans for /var/sadm/pkg/*/install/obsolete. If it finds /var/sadm/pkg/CSWlibfoo/install/obsolete and nothing installed depends on CSWlibfoo, then CSWlibfoo gets removed from the system - Support key package (/etc/opt/csw/pki, /var/opt/csw/pki). Change default homedir (Ben Walton) - Parse option for download, incl. catalog and md5 (Maciej Blizinski) - Include distribution (e.g. unstable) with pkgliststyle 2 - Support absolute paths in --output (Dago) - Show last two parts of mirror path as distribution (e.g. dublin/core) - Change default pkgliststyle to 2 - Speed up option -l with glob - Silence "Checking integrity ..." when --parse is on (4693@OpenCSW) - pkgutil: eval 'PATH=/opt/csw/bin:$PATH exec perl -x -w $0 ${1+"$@"}' (PCA) - pkgutil: fix pkgask/response bug (3205333@SF) (Julian Clifton-Thompson) - pkgutil: fix a bug in --cleanup when using --yes or auto (admin not set) - Do not duplicate mirrors present in pkgutil.conf in both /opt and /etc (4693@OpenCSW) - Fix bug in hook support (Ben Walton) - bldcat: add -q/--quiet option - bldcat: improve support for non-CSW packages (3300709@SF) (Mark Heily) - chkcat: add -c/--nocyclic option to skip cyclic dependency checking, helps speed a lot - chkcat: suppress warning exit code 1 when using --erroronly - chkcat: multiple catalog files can be specified and checked as a set (Maciej Blizinski) * v2.3. Released 2011-02-12 - Add option --parse for machine parsable output. No headers are displayed and columns are separated by a tab. Works with -a/A/c/C and --describe - Add option -l/--list to list installed packages only with names - When an upgrade includes pkgutil, pkgutil is always completely upgraded before proceeding with the rest of the packages - Exit with status 0 when comparing a single pkg not in catalog (to help Puppet) - Do not prompt at pkgadd error when using --yes, exit immediately instead (Mark Bannister) - Add deptree_filter_common (pkgutil.conf option) missing from pkgutil -V output - Better handle packages not in catalog (Mark Bannister) - Add fuzzy matching as last resort when using -a - Redirect some messages to STDERR - Prefix debug messages with DEBUG - Fix bug with last resort wget (Claes Lindvall) - bldcat: play nice with old catalogs that are gpg signed (Mark Bannister) - bldcat: do not reuse info if filename changed (Mark Bannister) - chkcat: fix bug with gpg signed catalogs (Mark Bannister) * v2.2. Released 2010-10-21 - Add option --deptree to display dependencies in a similar way to ptree (3078744@SF) - Add option -A/--compare-avail to compare catalog with local packages (Mark Bannister) - Add auto mode install/remove (on the fly --yes) (Ben Walton) - New option (deptree_filter_common) in pkgutil.conf to filter out CSWcommon from --deptree output - Add long option name, --compare-diff, to -C (Mark Bannister) - Add list of downloaded packages when using -d (Dago) - Modify download list output (4530@OpenCSW) (Dago, Sebastian) - Add info about which catalog is being gpg checked (Mark Bannister) - Display number of loaded packages per catalog (when updating the catalog or using debug) (Mark Bannister) - Group install/remove output better (Dago) - Change default URL to http://mirror.opencsw.org/opencsw/unstable - User agent example in pkgutil.conf - Fix bug with exit-prompt (y not default) - More robust downloads - Recommend CSWcoreutils instead of obsolete CSWtextutils for MD5 support - Documentation fixes - bldcat: improve speed with --fast option (Dago) * v2.1. Released 2010-07-28 - Option to suppress list of current packages - Shows number of packages, e.g. 24 CURRENT packages - Faster checking if a package is installed - Safe file and dir creations in pkgutil, bldcat and chkcat - More complete support for alternate root path - Documentation fixes - Add mask to mkdir to restore compatibility with Perl 5.5.3 in Solaris 8 (Thomas Pawlikaniec) - Add pkgutil to signal handler output - Clean version fields from non-digits during compares (Mark Bannister) - Fix detecting end of REV list during compares (Mark Bannister) - Fix bug with packages containing dashes when using remove - Fix bug with -x, now uses pattern just like in pkgutil.conf - Add GNU stub to bldcat and chkcat - bldcat: add missing -W in perldoc/man page - bldcat: fix bug with trailing slash on package dir - bldcat: fix bug with package dir being included in filename (Mark Bannister) * v2.0. Released 2010-06-08 - Improve loop algorithm, improves speed (Joe Baro) - Non-root use now use ~/.pkgutil instead of current dir - Add support for alternate root path (4117@OpenCSW) - Add unrecognized option message (Sebastian) (4395@OpenCSW) - Change project-URL to pkgutil.net - Make descriptions file missing non fatal - Use wgetopts in pkgutil.conf for advanced wget options like proxy settings - Add support for the non-CSW option in pkgutil.conf to the remove feature (2907656@SF) - Fix for stream option (3008549@SF) - Fix number shown when removing during upgrades - Fix bug with exclude - Fix bug with -N - Fix bug with removed admin file when multiple instances are detected (Dago) - Fix that chkcat doesn't work with non-CSW - Improve documentation for bldcat and chkcat - Change default in bldcat to 9 fields - chkcat: check that CSWcommon and CSWgzip are uncompressed - bldcat: fix bug about skipping SUNW deps - chkcat: warn about SUNW deps - chkcat: error when number of fields not 8 or 9 * v1.10. Released 2010-03-10 - Add -p/--param option to override configuration options from pkgutil.conf (4045@OpenCSW) - Add pkgutil.conf option to not cache fetching of catalogs - Health check for gzip and wget binaries - Added signal handling - Making some output more consistent and copy/paste friendly - Display the full target path when using --extract (4154@OpenCSW) - Nicer exits should not leave stale lock files (3994@OpenCSW) - Fix bug with -V and --config combo (4116@OpenCSW) - Fix that option -N/--nodeps didn't work with -u/--update (4172@OpenCSW) - Fix uninitialized value bug (4296@OpenCSW) - Fix gpg bug with international LANG setting (4289@OpenCSW) - Add comment about -S to not show license during install (pkgadd option) - Fix release dates for v1.9.1 in readme and add link to Maciej's script in readme for pkgutilplus - Merge modified part of patch from Blastwave fork (check exit status from pkgadd) - Change missing dependencies from warning to error in chkcat - Add -W/--workdir option to bldcat to set workdir (Maciej) - Mirror-script added (to pkgutilplus) to create mirror structure, uses bldcat (Dagobert Michelsen) * v1.9.1. Released 2009-12-10 - cswpkgloghooks added as a dependency to pkgutilplus, adds logging of package maintenance actions - Maciej Blizinski's build_sun_catalog.py script added to pkgutilplus, it builds CSW catalogs from Sun packages - gpg homedir support (Maciej Blizinski) - Make -a/c/C and --describe case sensitive (2908177@SF) (David Everly) - Fix upgrade all bug (2907651@SF) (David Everly) - Fix bug with system calls (Bartosz Trudnowski) * v1.9. Released 2009-11-27 - Add --single (used with -c) to quickly check one package (Maciej Blizinski) - Add --force option to sync with mirror. You can install or update to the version on the mirror even if your local version is newer - Add exclude_pattern option to pkgutil.conf, use simple patterns to exclude packages from install/upgrade (Maciej Blizinski) - Remove all upgrade packages first (2890862@SF) (David Everly) - Add support for response (pkgask) files (2890896@SF) (David Everly) - Local package files can now be upgraded as well (Sebastian Kayser) - Enhance description of noncsw option in pkgutil.conf (3990@OpenCSW) (Sebastian Kayser) - Default maxpkglist (loop detection) value raised to 250000 to decrease risk of false alarm (Sebastian Kayser) - Fix -F bug (4039@OpenCSW) (Sebastian Kayser) * v1.8. Released 2009-10-30 - Simple pkgutil logging script included in pkgutilplus using the new hook mechanism - Added pre/postargproc hooks (Ben Walton) - Support I-dependencies (remove incompatible packages) when using new 9-field catalog - Added pre/postfetch hooks (Ben Walton) - Install local package files, e.g. "pkgutil -i foo.pkg.gz" (Trygve Laugstol) - Fix transform (extract) feature (3904@OpenCSW) - Transform renamed to extract to be more generic (Sebastian Kayser) - Extract and stream must now be used with download, e.g. "-d --stream" - Selecting target platform is now possible for --download and --extract, not just --stream (3914@OpenCSW) (Sebastian Kayser) - Catalog update interval user configurable via pkgutil.conf. Set to -1 for no automatic updates, 0 for every time pkgutil is run and 1+ for the number of days between updates. 14 would emulate current behavior (Trygve Laugstol) - Add support for catalog names in --listfile (3894@OpenCSW) (Sebastian Keyser) - Split package into core pkgutil and extension pkgutilplus (bldcat/chkcat, more to come) - Remove unused declaration causing noise when using -r (3903@OpenCSW) - Fix missing options in man/perldoc page - Add support for non-CSW packages to bldcat (2865123@SF) (David Everly) - Switch back to default 8 field catalogs for bldcat and chkcat - bldcat and chkcat doesn't require CSWperl, exit with helpful message if Digest::MD5 is missing (3917@OpenCSW) * v1.7. Released 2009-09-11 - Clarify text about config file priority (2835200@SF) (Ken Stailey) - Add config status to --syscheck option (2855094@SF) (Dagobert Michelsen) - Add protection against concurrent pkgutil processes (3831@OpenCSW) - New option -N (nodeps) to skip dependencies, you get only what you specified on the command line - New option --transform to download and transform (unpack) packages (Sebastian Kayser) - New option -L (listfile) to list files in packages. Also works on package files, you can even mix them on the command line - New option -F (findfile) to see which package a file belongs to - New option --describe to describe available packages - New feature: package hooks (Ben Walton) - Loop protection (against circular dependencies in the catalog) - Optional new presentation of the needed packages during install/upgrade, one package per line to enhance readability. Package list is now sorted as well. Set pkgliststyle to 1 in pkgutil.conf - Cyclic dependency detection added to chkcat - Support new catalog format with added field for incompatible packages. Use -f8 in bldcat and chkcat to use the old format * v1.6.1. Released 2009-06-05 - Fix -y bug when upgrading pkgutil (3701@OpenCSW) (Sebastian Kayser, Dagobert Michelsen) - Fix order of install to ,e.g., make sure that cswclassutils is always installed first/early (3702@OpenCSW) (Sebastian Kayser) * v1.6. Released 2009-05-29 - Fix -T bug (3689@OpenCSW) (Sebastian Kayser) - Fix -W bug (3688@OpenCSW) (Sebastian Kayser) - New option -C, same as -c but only shows different versions, no more piping to grep -v SAME (Ben Walton) - New option --trace to debug pkgadd/pkgrm operations (#3683) (Yann Rouillard) - Replaced some system commands with native Perl - New option --config for using custom configuration file (Don Jackson) - Fix size formatting - Skip showing pkgadd patch when using -V on 5.11 (Dennis Clarke) - Update credits in perldoc/man page - Perldoc/man page added to both bldcat and chkcat - chkcat now includes more tests (Derek Whayman) - chkcat exit values are 0 for OK, 1 for warning and 2 for error - New option -e (erroronly) added to chkcat to supress warnings - New option -q (quiet) added to chkcat to supress all output * v1.5. Released 2009-04-09 - Support multiple catalogs with multiple versions of each package and selecting specific versions (Derek Whayman) - Performance enhancements (Derek Whayman) - Fix catalog update issue when mirror catalog is old (Ivo De Decker) - Increased protection against broken/empty local package files (Sebastian Kayser) - Perldoc/man updates - bldcat skips dependencies to the same package - chkcat checks for packages that contain dependencies to themselves * v1.4. Released 2009-01-19 - Dependency calculations are now much faster - Support for local file repositories (Dennis Clarke) - Keyword "same" when using -c replaced with "SAME" (Dennis Clarke) - bldcat now skips SUNW packages as dependencies * v1.3.1. Released 2008-12-17 - Small packaging bug fixed. No code changes * v1.3. Released 2008-12-12 - New option -x (exclude) to exclude packages (Ihsan Dogan) - New option -s (stream) to build a custom package (Dagobert Michelsen) - New option -T (target) to set architecture and release for package stream (-s) - New option -o (output) names the package stream from -s (Dagobert Michelsen) - New option -W (workdir) to set another directory to use for downloads. Some operations are now possible without being root - Option -f (force) renamed to -y (yes) (Dagobert Michelsen) - Make config file more NFS/read-only friendly (Dagobert Michelsen) - Changed default mirror from unstable to current (Dagobert Michelsen) - Fixed bug which caused a warning to be displayed during some upgrades - Fixed that locally cached packages are also MD5 checked (Dennis Clarke) - PATH added to -V (syscheck) output - Wget and Perl binaries added to -V - Documented admin file in perldoc/man page - Several changes in bldcat to improve speed (Dagobert Michelsen) - bldcat supports the description file (Dagobert Michelsen) - chkcat in verbose mode benefits from the same speed fix as in bldcat - chkcat now checks for missing dependencies * v1.2.1. Released 2008-11-28 - Fixes compare bug with package names containing dashes * v1.2. Released 2008-11-12 - Temp site (-t) does no longer replace the mirror defined in pkgutil.conf. It instead is considered the primary location and the mirror defined in pkgutil.conf is considered the secondary. That means you can point -t to your own repository of packages that are built with dependencies to CSW and it will fetch all packages necessary regardless of their location - Better MD5 support for Solaris 8 and 9 - Arguments to -a and -c are now treated like filters so "pkgutil -a bind dhcp" equals "pkgutil -a | egrep -i 'bind|dhcp'" - Changed version info to be -v instead of -V - Added -V (syscheck) to show info about binaries and more that pkgutil needs to support all features - Perldoc/man page updated with configuration file info - Search for gzip in more places - fixed bug when reporting package missing in catalog (Dagobert Michelsen) - bundled wget binaries moved to /opt/csw/libexec/pkgutil - bldcat supports CSW_CATEGORY - bldcat now extracts data in a more dependable way - chkcat checks for duplicates in catalog - chkcat with option -v checks the catalog data against actual package files if they are located in the same directory as the catalog parsed * v1.1. Released 2008-10-24 - Added possibility to use both common name and package name - Added bldcat to build catalalogs from package files - Added chkcat to check catalogs for errors - Fix for packages that are not compressed (e.g. gzip) - Fix for size zero local files (failed package downloads) - Fix for gpg-checks when updating the catalog (Yann Rouillard) - Fix for version compare code rule #3 (Yann Rouillard) - Updated prototype for package (Dennis Clarke) * v1.0. Released 2008-10-07 - Initial release - Version compare method by James Lee and Dagobert Michelsen - Tested to work on Solaris 8 with default Perl 5.5.3 -- $Id: readme 457 2012-08-15 10:33:22Z bonivart $ 0707010020a362000041ed000027130000271000000003502b7c6500000000000000c300000fc500000000000000000000001100000000root/opt/csw/var0707010020a363000041ed000027130000271000000002502b7c6500000000000000c300000fc500000000000000000000001900000000root/opt/csw/var/pkgutil0707010020a364000081a4000027130000271000000001502b7c5f000000a7000000c300000fc500000000000000000000002300000000root/opt/csw/var/pkgutil/admin.CSWmail= instance=overwrite partial=nocheck runlevel=nocheck idepend=nocheck rdepend=nocheck space=nocheck setuid=nocheck conflict=nocheck action=nocheck basedir=default 0707010020a34c000041ed000027130000271000000003502b7c6500000000000000c300000fc500000000000000000000000900000000root/etc0707010020a34d000041ed000027130000271000000003502b7c6500000000000000c300000fc500000000000000000000000d00000000root/etc/opt0707010020a34e000041ed000027130000271000000002502b7c6500000000000000c300000fc500000000000000000000001100000000root/etc/opt/csw0707010020a34f000081a4000027130000271000000001502b7c5e000011b1000000c300000fc500000000000000000000002200000000root/etc/opt/csw/pkgutil.conf.CSW# Configuration file for pkgutil # $Id: pkgutil.conf 448 2012-02-04 14:22:21Z bonivart $ # Master configuration file is placed in /opt/csw/etc. Place a pkgutil.conf # file in /etc/opt/csw if you want a local override setting-by-setting. # Nothing below is mandatory to change, pkgutil will use the default values # noted below for each option unless something is uncommented. # Catalog not cached # Tells your proxy server to disable caching during fetching # of the catalog and descriptions. # Default: true #catalog_not_cached=true # Catalog update interval # Number of days between automatic catalog updates. Special cases are -1 # if you want to disable automatic updates and 0 if you always want to # update the catalog. # Default: 14 #catalog_update=14 # Filter out CSWcommon from --deptree output # Set this to true if you don't want to see lots of lines with CSWcommon. # Default: false #deptree_filter_common=true # Exclude pattern # Space separated list of simple patterns that will exclude matching packages # when updating or installing. # Default: blank #exclude_pattern= # gpg homedir # The path to the gpg directory (instead of ~/.gnupg) when verifying the # catalogs integrity. # NOTE: we recommend you install the CSWcswpki package for # easiest handling of the keys # Default: blank #gpg_homedir= # Max package list length # During dependency calculation the recursive algorithm needs to be protected # against cyclic dependencies in the catalog (packages that list each other # as dependencies) or pkgutil will not stop until memory is exhausted. # Default: 100000 #maxpkglist=100000 # Mirror to use for downloads # See http://www.opencsw.org/mirrors for alternative mirrors. # NOTE: remember to include distribution (e.g. testing) at the end of the url. # NOTE: you can have multiple mirrors by defining multiple mirror lines. # Default: http://mirror.opencsw.org/opencsw/testing #mirror=http://mirror.opencsw.org/opencsw/testing # Support non-CSW packages # If you have your own packages that have a different prefix that you want # to use with pkgutil you must enable this otherwise pkgutil will skip every # package not prefixed by CSW. # NOTE: this also affects options like -c/C, however it's easy to filter the # output if wanted, e.g. "pkgutil -C CSW". # Default: false #noncsw=true # Options to use for pkgadd # You can set it to -S to skip displaying the license during install. # Solaris 10: If you wish to limit pkgutil to installing packages # only to the global zone, set it to -G. Note that pkgrm # does not have the same option. # WARNING: do not modify this unless you know what you're doing. # Default: blank #pkgaddopts=-G -S # Style of package list when installing/upgrading packages # 0 is the one used since the first version of pkgutil, it's space efficient # but less readable. 1 is the one introduced in v1.7, it's one package per # line which is easier to read. 2 is the same as 1 but also displays which # distribution a package comes from, e.g. unstable or stable. # Default: 2 #pkgliststyle=2 # Options to use for pkgrm # Solaris 10: If you wish to limit pkgutil to removing packages # only in the global zone, set it to -O nozones. # WARNING: do not modify this unless you know what you're doing. # Default: blank #pkgrmopts=-O nozones # Root path to use # WARNING: do not modify this unless you know what you're doing. # Default: / #root_path=/a # Show the current list of packages or not # You can choose to not show the list of current packages to get less output # when doing operations. # Default: true #show_current=true # How to handle soft errors from hooks that are called # A hook that exits with code 1 will cause pkgutil to stop. If this value is # true, exit code 2 will also cause pkgutil to stop. Exit code 2 is a non-fatal # error condition from a hook and it is a site dependent choice whether or # not to honour this condition. Set to true to enable. # Default: false #stop_on_hook_soft_error=false # Use of gpg, md5 # To enable use of gpg or md5, uncomment these # NOTE: it doesn't make sense to use md5 but not gpg so your options should be: # 1. both disabled, 2. gpg enabled, 3. both enabled. # Default: false, false #use_gpg=true #use_md5=true # Options to use for wget # You can also use any option from wgetrc with --execute, e.g. # "--execute http_proxy=http://proxy.foo.bar". # WARNING: do not modify this unless you know what you're doing. # Default: blank #wgetopts=-U pkgutil 07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!